KEGG   Streptomyces lydicus 103: SL103_19940Help
Entry
SL103_19940       CDS       T04699                                 

Definition
(GenBank) phenolic acid decarboxylase subunit B
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00130  Ubiquinone and other terpenoid-quinone biosynthesis
slc00627  Aminobenzoate degradation
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SL103_19940
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SL103_19940
Enzymes [BR:slc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SL103_19940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AOP48196
UniProt: A0A1D7VN62
Position
complement(4606283..4606879)
Genome map
AA seq 198 aa AA seqDB search
MRLIVAMTGATGAPLGVRLLENLRELPDVRTHLILSRWARATIELETGRSVRDVGGLADE
VHHPEDQGATLSSGSFRTDGMVIVPCSMKTLAGIRAGYADGLIARAADVVLKERRKLVLV
PRETPLSEIHLENMLALARMGVQMVPPVPAFYHRPASVDDIVDHLTARILDQFELPAPAA
RRWAGMRAARTAAPGTAA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctgatcgtggcaatgaccggagcgaccggcgcgcccctcggggtgcgcctgctg
gagaacctgcgagagctcccggacgtccggacccatctcatcctctcccgctgggcacgc
gccacgatcgagttggagaccggccgctcggtacgcgacgtcggcgggctcgccgacgag
gtgcaccaccccgaggaccagggcgccaccctctcctccggctccttccggaccgacggc
atggtgatcgtgccgtgctcgatgaaaaccctcgccggcatccgcgccggctacgccgac
ggcctgatcgcccgcgccgccgacgtcgtcctcaaggagcgccgcaagctcgtgctcgtc
ccgcgcgagacgccgctcagcgagatccacctggagaacatgctcgcgctggcccgcatg
ggcgtccagatggtgccgccggtgccggcgttctaccaccggccggcctccgtcgacgac
atcgtcgaccacctcaccgcgcgcattctcgaccagttcgagctgcccgcccccgccgcc
cggcgctgggcgggcatgcgcgcggcccgcaccgccgcccccggcaccgcggcctga

DBGET integrated database retrieval system