KEGG   Streptomyces lydicus 103: SL103_22560Help
Entry
SL103_22560       CDS       T04699                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00998  Biosynthesis of secondary metabolites - other antibiotics
slc00999  Biosynthesis of secondary metabolites - unclassified
slc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SL103_22560
   00999 Biosynthesis of secondary metabolites - unclassified
    SL103_22560
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SL103_22560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Semialdhyde_dh 2-Hacid_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AOP48648
UniProt: A0A1D7VQ67
Position
5167034..5168029
Genome map
AA seq 331 aa AA seqDB search
MTVIGAADIAAETDRHRPELIDVVRAAYLAHDAGQSSNPHSSFLRFPHRSRSRIISLPAY
LGGEFEVAGNKWIASFPDNTQHGIPRASATLILNDCVTGYPFACMESSIISATRTAASAV
LGARTLLGARRARRVGIVGTGLIAQHVWRFLRDLDWEIDGFRLFDLDPAAAGRFGAVMAE
HTEAEIVVADTVEDAFTDCDLVVLTTVAGEPHLHDPRLLSHNPVVLHLSLRDLAPEMILA
AQNFTDDVDHAVRERTSLHLTEQRTGNRDFVDGTLGDLLRGRQRRDHGRPAIFSPFGLGV
LDLAVGKWVHDRVVAAGRGRRESDFFTGVGV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgatcggcgcagccgacatcgccgccgagacggaccgtcaccgtccggagctc
atcgacgtcgtccgtgccgcctacctcgcgcacgacgcgggacagagctcgaacccgcac
agttcgttcctgcgcttcccgcaccggagccggtcgcgcatcatctccctgcccgcgtat
ctagggggtgagttcgaggtcgccggcaacaagtggatcgccagttttccggacaacacg
cagcacggtatcccccgcgcctcggccacgctgatcctcaacgactgcgtcaccggctac
ccgttcgcctgcatggagtcctcgatcatctcggcgacgcggaccgcggcctccgcggtg
ctcggcgcgcggacgctgctcggcgcgcgccgtgcccgccgagtcggcatcgtgggcacg
ggtctgatcgcccagcacgtatggcggttcctgcgtgatctcgactgggagatcgacggc
ttccggctcttcgacctcgatccggcggcggcgggccgcttcggcgccgtcatggccgag
cacaccgaggccgagatcgtggtcgccgacacggtggaggacgcgttcaccgactgcgac
ctggtggtgctgaccaccgtggccggcgagccgcacctgcacgacccccggctgctgtcc
cacaacccggtggtcctgcacctgtccctgcgcgacctcgcccccgagatgatcctcgcc
gcccagaacttcaccgacgacgtcgaccacgccgtacgcgagcgcacctcgctgcacctg
accgaacagcgcaccggcaaccgggacttcgtcgacggcaccctcggcgacctgctgcgc
ggacgacagcgccgggaccacggacgcccggcgatcttctcaccgttcggactcggcgta
ctcgacctcgccgtcggcaagtgggttcacgaccgggtcgtcgccgcgggccggggccgc
cgcgagagcgacttcttcaccggggtgggggtctga

DBGET integrated database retrieval system