KEGG   Streptomyces lydicus 103: SL103_30510Help
Entry
SL103_30510       CDS       T04699                                 

Definition
(GenBank) fructose-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00010  Glycolysis / Gluconeogenesis
slc00030  Pentose phosphate pathway
slc00051  Fructose and mannose metabolism
slc00680  Methane metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01200  Carbon metabolism
Module
slc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL103_30510
   00030 Pentose phosphate pathway
    SL103_30510
   00051 Fructose and mannose metabolism
    SL103_30510
  09102 Energy metabolism
   00680 Methane metabolism
    SL103_30510
Enzymes [BR:slc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SL103_30510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AOP50009
UniProt: A0A1D7VTC5
Position
7045618..7046649
Genome map
AA seq 343 aa AA seqDB search
MTEHHLPSQLEVSPEAPDRNLALELVRVTEAGAMASGRWVGRGDKNGADGAAVKAMRALI
HTVSMNGVVVIGEGEKDHAPMLYNGERVGDGTGPECDVAVDPVDGTTLTAKGMANAVSVM
AVAERGAMFDPSAVFYMDKLATGPEAADFVDITAPVAVNIKRIAKAKKSAVEDVTVVILD
RPRHEGLVKEVREAGARIKFISDGDVAGAIMAAREGTGVDLLLGIGGTPEGIITACAMKC
LGGTLQAKLWPKDDEERQRALDAGHDLDKVLQIDDLVRSDNVFFVATGITDGELLRGVRY
RAETAYTQSLVMRSKSGTIRQIDSQHRLSKLRAYSSVDFERPS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcatctcccgtcccaactcgaggtcagccccgaggccccggaccgcaac
ctcgccctggaactcgtccgggtgaccgaggccggtgccatggcgtcgggccgctgggtg
ggccgaggcgacaagaacggcgcggacggcgcggcggtcaaggccatgcgcgccctgatc
cacaccgtctcgatgaacggcgtcgtggtcatcggggagggcgagaaggaccacgccccg
atgctctacaacggtgagcgggtcggcgacgggaccggcccggagtgcgatgtggccgtg
gacccggtggacggcacgacgctgaccgccaagggcatggcgaacgccgtctccgtgatg
gcggtcgccgagcgcggcgcgatgttcgacccgtccgcggtgttctacatggacaagctg
gcgaccgggccggaggcggcggacttcgtcgacatcacggcgccggtggcggtcaacatc
aagcggatcgccaaggccaagaagtccgcggtcgaggacgtcaccgtggtcatcctggac
cggccgcgccacgagggcctggtcaaggaggtccgggaggccggtgcccggatcaagttc
atctccgacggcgacgtcgccggcgcgatcatggcggcccgcgagggcaccggcgtcgac
ctgctgctgggcatcggcggtacccccgagggcatcatcaccgcctgcgcgatgaagtgt
ctgggcggcacgctgcaggccaagctgtggccgaaggacgacgaggagcggcagcgcgcg
ctggacgccgggcacgacctggacaaggtgctccagatcgacgacctggtccgcagcgac
aacgtcttcttcgtcgccaccggcatcaccgacggcgagctgctgcgcggcgtgcgctac
cgcgccgagaccgcctacacccagtccctggtgatgcgctccaagtccggcacgatccgg
cagatcgactcccagcaccggctgtcgaagctgcgcgcgtacagctcggtggacttcgag
cgccccagctag

DBGET integrated database retrieval system