KEGG   Streptomyces lydicus 103: SL103_31670Help
Entry
SL103_31670       CDS       T04699                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00020  Citrate cycle (TCA cycle)
slc00640  Propanoate metabolism
slc00660  C5-Branched dibasic acid metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01200  Carbon metabolism
Module
slc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL103_31670
   00640 Propanoate metabolism
    SL103_31670
   00660 C5-Branched dibasic acid metabolism
    SL103_31670
Enzymes [BR:slc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SL103_31670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AOP50218
UniProt: A0A1D7VUP4
Position
complement(7306313..7307197)
Genome map
AA seq 294 aa AA seqDB search
MAIFLTKESKVIVQGMTGATGMKHTKLMLGDGTNIVGGVNPRKAGTSVDFDGTEVPVFGS
VKEAMEKTGADVSVLFVPPAFAKAAVVEAIDAEIPLAVVITEGIAVHDSAAFWAYAKSKG
NKTRIIGPNCPGLITPGQSNAGIIPGDITKPGRIGLVSKSGTLTYQMMYELRDIGFSSAV
GIGGDPVIGTTHIDALAAFEADPDTDLIVMIGEIGGDAEERAADFIKANVTKPVVGYVAG
FTAPEGKTMGHAGAIVSGSSGTAQAKKEALEAAGVKVGKTPSETARLAREILVG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatcttcctgaccaaggaaagcaaggtcatcgtccagggcatgaccggtgccact
ggcatgaagcacaccaagctgatgctcggtgacggcaccaacatcgtcggcggtgtcaac
ccgcgcaaggccggcacctccgtcgacttcgacggcaccgaggtcccggtcttcggctcc
gtcaaggaagcgatggagaagacgggcgccgacgtctccgtcctcttcgtgccgccggcc
ttcgccaaggccgccgtcgtcgaggcgatcgacgccgagatcccgctcgccgtcgtgatc
accgagggcatcgcggtccacgactccgccgccttctgggcgtacgcgaagtccaagggc
aacaagacccgcatcatcggcccgaactgccccggcctgatcacccccggccagtccaac
gccggcatcatcccgggcgacatcaccaagcccggccgcatcggcctggtgtcgaagtcc
ggcacgctgacctaccagatgatgtacgagctccgtgacatcggcttctcctcggccgtc
ggcatcggtggcgacccggtcatcggcaccacccacatcgacgccctcgcggcgttcgag
gcggaccccgacaccgacctgatcgtcatgatcggcgagatcggcggcgacgccgaggag
cgtgcggccgacttcatcaaggccaacgtcaccaagccggtcgtcggctacgtcgcgggc
ttcaccgcgcccgagggcaagaccatgggccacgccggcgccatcgtctccggctcctcc
ggcaccgcccaggcgaagaaggaggccctcgaggccgccggcgtcaaggtcggcaagacc
ccgtcggagaccgcgcgcctggcccgcgagatcctcgtcggctga

DBGET integrated database retrieval system