KEGG   Streptomyces lydicus A02: T261_0547Help
Entry
T261_0547         CDS       T03756                                 

Definition
(GenBank) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00780  Biotin metabolism
sld01100  Metabolic pathways
Module
sld_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    T261_0547
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sld01007]
    T261_0547
Enzymes [BR:sld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     T261_0547
Amino acid related enzymes [BR:sld01007]
 Aminotransferase (transaminase)
  Class III
   T261_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJT62236
UniProt: A0A0D4DEI5
Position
567872..569179
Genome map
AA seq 435 aa AA seqDB search
MPEPFLTPGELLALDRQHVWHPYGPMPGRAEPLLVESASGVRLRLGRPAEGRTELVDGMS
SWWSAVHGYNHPVLNEAARGQLERMSHVMFGGLTHEPAVRLAKRLVDITPEPLEHVFLAD
SGSVSVEVAVKMCLQYWRSLGRPRKQRLLTWRGGYHGDTWQPMSVCDPDGGMHELWQGVL
PRQIFAEAPPAGFDAAPDEAYAAHLRELIARHAEELAAVIVEPVVQGAGGMSFHSPAYLR
VLREACDAHDVLLVFDEIATGFGRTGSLFAAGHAGVSPDVMCVGKALTGGYLTLAATLCA
SGVADGISQGELPVLAHGPTFMGNPLAAAVADASIGLLLSQDWAQEVKRIEAGLRDGLAA
ASDITGVRDVRVLGAIGVVQLDHAVDMAAATRAAVRAGVWVRPFRDLIYTMPPYITGDDD
VARICAAVCAAAREG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccgttcctgacgcccggcgagctcctcgcgctcgaccggcagcacgtctgg
catccgtacgggccgatgcccggccgcgccgagccgctgctggtggagtcggcatccggc
gtccggctgcggctgggccggcccgccgaggggcggaccgagctggtggacggcatgtcg
tcgtggtggtcggcggtgcacggctacaaccacccggtgctcaacgaggcggcgcgcggc
cagctggagcggatgagtcatgtgatgttcggcgggctcacccatgagcccgccgtccgc
ctggcgaagcgtctggtcgacatcaccccggagccgctcgagcacgtcttcctcgccgac
tccggttcggtgtcggtcgaggtcgccgtcaagatgtgcctgcagtactggcgctcgctc
ggcaggccgcgcaaacagcggctgctgacctggcggggcggctaccacggcgacacctgg
cagccgatgtccgtctgcgatccggacggcgggatgcacgagctgtggcagggggtgctg
ccgcgccagatcttcgcggaggcacccccggccggcttcgacgccgcgcccgacgaggcc
tacgcggcgcatctgcgcgaactgattgcccgtcacgccgaggaactggccgcggtgatc
gtggagccggtcgtccagggcgcgggcgggatgtccttccactcccccgcctacctccgg
gtcctgcgcgaggcctgcgacgcgcacgacgtgctgctcgtcttcgacgagatcgccacc
ggcttcggccgtacgggcagcctcttcgccgccggacacgccggcgtctcaccggacgtc
atgtgtgtgggcaaggccctgaccggcggctatctgaccctcgcggcgaccttgtgcgcg
tccggcgtcgccgacggcatctcccagggggagctgcccgtcctggcccacggccccacc
ttcatgggcaatcccctcgccgccgccgtggccgacgcctccatcgggctcctcctctcc
caggactgggcgcaggaggtcaaacggatcgaggccgggctgcgggacgggctggcggcg
gcctcggacatcaccggcgtacgggacgtccgggtcctcggcgcgatcggtgtcgtccag
ctcgatcatgccgtggacatggcggccgcgacccgggcggcggtccgcgcgggcgtctgg
gtgcggccgttccgggatctgatctacaccatgccgccgtacatcaccggtgacgacgat
gtggcgcggatctgcgccgcggtgtgcgccgcggcgcgcgaaggctga

DBGET integrated database retrieval system