KEGG   Streptomyces lydicus A02: T261_1104Help
Entry
T261_1104         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00071  Fatty acid degradation
sld00380  Tryptophan metabolism
sld00627  Aminobenzoate degradation
sld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T261_1104
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    T261_1104
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    T261_1104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sld00199]
    T261_1104
Enzymes [BR:sld01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     T261_1104
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     T261_1104
Cytochrome P450 [BR:sld00199]
 Cytochrome P450, bacteria type
  CYP102 family
   T261_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 FAD_binding_6 Flavodoxin_5 PG_isomerase_N
Motif
Other DBs
NCBI-ProteinID: AJT62792
UniProt: A0A0D4DGJ2
Position
complement(1132054..1135245)
Genome map
AA seq 1063 aa AA seqDB search
MTDTIALHSDERAADDGIPVADITAAGLTSTPLQQAMDLARVHGPVFRRRLGDRETLLVS
SLDLVTELADESRFAKGVSAILENVREFAGDGLFTAYNDEPNWAKAHEVLMPAFALGSMR
TYHPAMLKVARRVMAAWDRRVADGRAVDVAEDMTRMTLDTIGLAGFGFDFESFARDTPHP
FVESMVRCLQWSGAKFARKPGADHSAEDAAFRADADYLASVVDEVIAARTASGESGDDDL
LGLMLGSRDQGDGAAAGGPALDLANIRNQVITFLIAGHETTSGALSFALYHLLKDPSALR
LAQREADELWGDDPDPDPSFEDIGRLPYIRQVLNESLRLWPTAAAFTRQAQQDTVLGGRY
PLRKGDLLTVLTPMLHRDPAWGDNPDLFDPSRFAPEAEAARSPHAYKPFGTGERACIGRQ
FALHEATMLLALLVHRYRLIDHTGYRLRIKETLTLKPENFTLTLAARTPADRAATRAALA
VLPGGGATAAGEGAAAATDDGLPTRVPQGTGLLLLHGTNYGTCREFAERLADEATGLGFT
TEVAPLNAYAGGLPADRPVAIVAASYNGQPTDDAAAFVSWLRTAEEGAAEGVPYAVLGVG
DRNWAATYQHVPTLIDDRLDALGAERLVPRAEADASGNLNGTVKEFALALRTQLLTRYGD
PASTGAGAPAAEETRYTVTEVTGGPLDALAARHDLVEMTVTEAYDLTAPDWPRPKRFLRI
ALPDGVTYRTADHLAVLPANAPAAVERAAQALGVGLDTVLSLHSGRPARDALPVDRPLTV
RQLLTHYLELGARPTPDQTALLAAHNPCPPERTALETLTDDDPRTLIDLIEDHPALRGAL
PWPVILELLPPLRTRHYSLSSSPATDGRHADLMVSLLPGGTGSTYLHGVRPGDTVLARVQ
PCREAFRLDPADPTPVIMIAAGTGLAPFRGAVADRVAAGRTSPARLYFGCDDPTGDFLHA
AELTAAQEAGAVSLRPVFSARPEHGHLFVQHRIAAEAAEVWELLQAGARVYVCGDGSRMA
PGVRDAFRALHGAAVGASPQESEAWLRELTAAGRYIEDVYAAG
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccatcgcgctgcactccgacgaacgcgccgccgacgacggcattccggtt
gccgacatcacggcggccggtctcacctcgacgccgctccagcaggccatggacctggcc
cgggtccacggtccggtcttccggcgccggctgggcgaccgcgagacgctgctcgtctcc
tcgctggacctggtcaccgaactcgccgacgagagccgcttcgccaagggcgtctcggcg
atcctggagaacgtccgggagttcgccggagacggtctgttcaccgcctacaacgacgag
ccgaactgggccaaggcgcacgaggtgctgatgccggccttcgcgctcggctcgatgcgg
acgtaccacccggcgatgctcaaggtggcgcgccgggtgatggccgcgtgggaccgccgg
gtcgccgacggcagggccgtcgacgtcgccgaggacatgacccggatgacgctggacacc
ataggactggccggcttcggcttcgacttcgagtcgttcgcccgggacaccccgcacccg
ttcgtcgagtcgatggtgcgctgtctccagtggagcggcgccaagttcgcccgcaagccc
ggagccgaccactccgccgaggacgcggcgttccgcgccgacgccgactatctggcctcc
gtcgtcgacgaggtcatcgccgcccggaccgcgagcggcgagagcggcgacgacgatctg
ctgggcctgatgctcggctcccgggaccagggggacggcgccgcggccggcgggcccgcc
ctggacctcgccaacatccgcaaccaggtgatcaccttcctgatcgccgggcacgagacc
acctcgggcgcgctctccttcgccctctaccacctgctgaaggacccgtccgcgctgcgt
ctggcccagcgcgaggcggacgagctgtggggcgacgacccggaccccgacccgtccttc
gaggacatcggccggctgccgtacatccggcaggtgctcaacgagtcgctccggctgtgg
ccgaccgccgccgcgttcacccggcaggcccagcaggacaccgtcctcggcggccgctac
ccgctgcggaagggcgatctcctcaccgtcctcacgccgatgctgcaccgcgacccggcc
tggggcgacaaccccgacctcttcgacccgtcccgcttcgccccggaggccgaggcggcc
cgctccccgcatgcgtacaagcccttcggcacgggtgaacgggcctgcatcggacggcag
ttcgcgctgcacgaggcgaccatgctgctcgcgctcctggtgcaccgctaccgtctgatc
gaccacacgggctaccggctgcgcatcaaggagacactgaccctcaagcccgagaacttc
acgctcaccctcgccgcccgtacgcccgcggaccgggccgcgacccgcgccgcgctcgcc
gtcctcccgggtggcggggccacggccgccggggaaggcgcagcggccgcgaccgacgac
ggcctgcccacccgcgtcccgcagggcaccgggctgctcctgctgcacggcaccaactac
ggcacctgccgggagttcgccgagcggctggccgacgaggccaccggcctgggcttcacc
accgaggtggcaccgctgaacgcctacgcgggcgggctgcccgccgaccggcccgtggcg
atcgtcgccgcctcctacaacgggcagccgaccgatgacgcggccgccttcgtgagctgg
ctgcgcaccgcggaggagggcgccgccgagggggttccctacgccgtcctgggtgtcggc
gaccgcaactgggccgcgacctaccagcatgtgccgacgctcatcgacgaccgcctcgac
gcgctcggcgccgagcgtctggtgccacgcgccgaggccgatgcctccggcaatctgaac
ggcaccgtcaaggagttcgccctcgcgctgcgcacacagctgctgacgcgctatggcgac
ccggcgagcaccggcgccggcgccccggccgccgaggagacccgttacaccgtgacggag
gtgaccggcggacccctggacgccctcgccgcccggcacgacctcgtcgagatgacggtc
accgaggcctacgacctgacggcgccggactggccgcgccccaagcgcttcctgcgcatc
gcgctgcccgacggggtcacctaccgcaccgccgaccatctcgccgtactccccgccaat
gccccggccgccgtcgaacgggccgcacaggcgctgggcgtcggcctcgacaccgttctc
tcgctgcactccggccgcccggcccgcgatgcgctccccgtcgaccgcccgctgaccgta
cgccaactcctcacccactacctggagttgggcgcgcggccgacccccgaccagacagcc
ctgctcgccgcccacaacccctgcccgcccgagcggacggcgctggagaccctcaccgac
gacgatccccggaccctgatcgacctgatcgaggaccacccggcgctgcgcggcgcgctg
ccctggccggtcatcctggagctgctgccgccgctgcgcacccggcactactccctctcg
tcctcgcccgccaccgacggccggcacgccgacctgatggtctcgctgctgcccggcggc
accggttcgacctatctgcacggggtgcggcccggcgacaccgtcctggcccgcgtccag
ccctgccgtgaggccttccgtctcgatccggccgaccccacccccgtcatcatgatcgcg
gccggcaccggtctcgcacccttccgcggtgccgtcgccgaccgcgtcgccgcgggccgc
acgtcgcccgcccggctctacttcggctgcgacgaccccaccggcgacttcctccacgcc
gcggagctcaccgccgcacaggaggcgggcgccgtctcgctccgcccggtcttcagcgcc
cgccccgaacacggccacctcttcgttcagcaccgcatcgccgccgaggccgccgaggtc
tgggagctgctgcaggccggcgcgcgggtctacgtctgcggcgacggcagccggatggcg
cccggcgtacgggacgccttccgcgcactgcacggcgccgcggtgggcgcctcgccccag
gaatccgaggcgtggctgcgcgaactgaccgccgccgggcgctatatcgaggatgtgtac
gccgcgggctga

DBGET integrated database retrieval system