KEGG   Streptomyces lydicus A02: T261_1921Help
Entry
T261_1921         CDS       T03756                                 

Definition
(GenBank) Non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00562  Inositol phosphate metabolism
sld00564  Glycerophospholipid metabolism
sld01100  Metabolic pathways
sld01110  Biosynthesis of secondary metabolites
sld02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    T261_1921
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    T261_1921
   00565 Ether lipid metabolism
    T261_1921
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    T261_1921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sld02042]
    T261_1921
Enzymes [BR:sld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     T261_1921
Bacterial toxins [BR:sld02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   T261_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AJT63606
UniProt: A0A0D4DII0
Position
complement(2051372..2053429)
Genome map
AA seq 685 aa AA seqDB search
MPELNRRRFLQIAGATAGVSALAGSIARAAAIPARRRTGSIKDVEHIVVLMQENRSFDHY
FGTMKGVRGFGDPRPVTLPNGKPVWNQPDGGKEVLPFHPDAEDLGMQFIAGLDHDWAGGH
KAFNNGKYDQWVPAKSERTMAYLTRQDIPFHYALADAFTVCDDYHCSFMGATDPNRYYML
SGHVGNDGKGGGPVLGNAELGYDWTTYAERLEQGGVSWKVYQDIGDGLDANGKWGWIEDA
YRGNYGDNSLLFFNKYRNAKPGDPLYDKARTGTNAKAGDGYFDVLKADVKAGKLPQISWI
AAPEAFSEHPNWPVNYGAWYISQVLDALTSNPDVWSKTALFITYDENDGYFDHIVPPYVP
ADANQGKSTVDTSLDYFPGDASYSAGHYGMGQRVPMIVVSPWSTGGYVCSEVLDHTSIIQ
FMEKRFGVKESNISPWRRAVAGDLTSAFDFSGKDTDPAKLPDTAGYQPPDHERHPDYVPH
APANPALPKQESGSRPTRPLPYAPLVDGSADPAAGKFTLTFSGGDAAGACFHVRSANRTD
GPWTYTTEAGKTISDTWNSAYSKDVYDLSVFGPNGFLRVFKGPGKTAGPEVTARHDGTTG
NLALTMKNPGKTDCHLKVAHAYGGASETFTVRAGATVKHTVDLRASKRWYDLTVTSDGDA
SFLRRFAGHVENGQVGVSDPAIITG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactcaaccgacggcgtttcctccagatagccggagccacggcgggtgtctcc
gcccttgccgggagcattgcccgggctgcggccattcccgcccggcgtcgtaccggctcc
atcaaggacgtcgagcacatcgtcgtcctgatgcaggaaaaccgttccttcgaccactac
ttcggcacgatgaagggtgtccgcggcttcggcgacccgcgtcccgtcacgctgccgaac
ggcaagccggtgtggaaccaacccgacggcggcaaggaagtgctgccgttccacccggac
gccgaggacctcggcatgcagttcatcgcgggcctcgaccacgactgggccgggggccac
aaggcgttcaacaacggcaagtacgaccagtgggtgccggccaagtccgagcggacgatg
gcgtatctgaccaggcaggacattccgttccactacgcgctcgccgacgcgttcaccgtc
tgtgacgactaccactgttcgttcatgggcgccaccgaccccaaccgctactacatgctg
tcgggccacgtcggcaacgacggcaagggcggcggcccggtcctcggcaacgcggagctc
gggtacgactggacgacctacgccgagcgcctggagcagggcggggtgtcctggaaggtg
taccaggacatcggtgacggtctggacgcgaacggcaagtggggctggatcgaggacgcc
taccgcggcaactacggcgacaactccctgctgtttttcaacaaataccgcaacgcgaag
cccggtgacccgctgtacgacaaggcgcgtaccgggaccaacgccaaggcgggcgacggc
tacttcgacgtgctcaaggccgatgtgaaggcgggcaagctcccgcagatctcctggatc
gccgcgccggaggcgttctccgagcaccccaactggccggtcaactacggtgcctggtac
atctcccaggtgctggacgcgctcacgtccaaccccgacgtgtggagcaagacggccctg
ttcatcacgtacgacgagaacgacggctacttcgaccacatcgtcccgccgtacgtcccg
gccgacgcgaaccagggcaagtccaccgtggacaccagcctcgactacttccccggtgac
gccagctactccgccggccactacggcatgggccagcgcgtcccgatgatcgtcgtgtcg
ccgtggagcaccggcggctatgtctgctccgaggtgctcgaccacacctcgatcatccag
ttcatggagaagcggttcggggtcaaggagtcgaacatctcgccctggcggcgggccgtc
gcgggcgacctgacctccgccttcgacttcagcggcaaggacaccgacccggcgaagctc
ccggacaccgccggctaccagccgccggaccacgagcgccaccccgactacgtcccgcac
gcccccgccaaccctgccctgcccaagcaggagtccggctcccggcccacccgcccgctg
ccgtacgcgcccctggtggacggctccgccgacccggcggccgggaagttcacgctcacc
ttcagcggtggcgacgcggccggtgcctgcttccacgtccggtccgccaaccgcaccgac
ggcccctggacgtacaccacggaggccggcaagacgatctccgacacctggaactccgcg
tactccaaggacgtttacgacctgtcggtgttcggcccgaacggcttcctgcgggtcttc
aagggccccggcaagaccgccggccccgaggtcaccgcccgccacgacgggaccaccgga
aacctcgccctgaccatgaagaacccgggcaagaccgactgccacctgaaggtcgcccac
gcctacggcggcgcgagcgagaccttcacggtgcgcgccggtgccaccgtcaagcacacg
gtggacctgcgggcgagcaagcgctggtacgacctgacggtgacctccgacggggacgct
tccttcctgcgccggttcgccgggcatgtcgagaacggccaggtgggcgtgagcgacccg
gcgatcatcaccggctga

DBGET integrated database retrieval system