KEGG   Streptomyces lydicus A02: T261_3872Help
Entry
T261_3872         CDS       T03756                                 

Definition
(GenBank) Germacradienol/geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00909  Sesquiterpenoid and triterpenoid biosynthesis
sld01100  Metabolic pathways
sld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    T261_3872
Enzymes [BR:sld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     T261_3872
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     T261_3872
    4.2.3.75  (-)-germacrene D synthase
     T261_3872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C Herpes_env
Motif
Other DBs
NCBI-ProteinID: AJT65534
UniProt: A0A0D4DNM3
Position
complement(4158488..4160725)
Genome map
AA seq 745 aa AA seqDB search
MTQPFELPNFYTPYPARLNPHLEEARRHSKEWARGMEMLEGSGIWEESDLEAHDYALLCS
YTHPDCSAEALSLVTDWYVWVFFFDDHFLERFKRTLDREGGKEYLDRLPAFMPMDTDTPV
PEPTNPVEAGLADLWARTVPAMSGEWRARFRESTENLLNESLWELSNINIHRVPNPVEYI
EMRRKVGGAPWSAGLVEYAAGAEVPAAVAASRPLRVLKDTFSDAVHLRNDLFSYQRETED
EGELSNGVLVLETFLGCTTQEAADAVNDLITSRLQQFEDTVCGELPVLFAERGLDPRACA
DVLAYAKGLQDWQSGGHEWHMRSSRYMNGGGTAATSGTAWSPFALDGLGTSAADLKSSLA
ASEIRRLRRYTHTPHQKVGPSRIPDIQMPFTASLSPHLDAARRNCIDWAHRMGLLEPQPG
VPHSGIWDERALAGYDFPLCSAGIDPDATPEELDLSSQWLTWGTYADDYYPAVFGRNRDL
AGARAANARLSSLMPLDASAPAPSPANAMERALADLWSRTAGPMTPEARSAFRAAVGTMT
DSWLWELDNQLQNRIPDPVDYIEMRRATFGSDLTMALCRIGHGRQIPAEIHRTGTLRSLE
NAAADYAMLVNDVFSYQKEIEYEGEVHNGILVVQNFFDCDYPTALAVINDLMTSRVREFQ
HVAANELPVLCDDFKLSADSRAALDAYVRELEDWMSGILVWHRDCHRYRESFLRHRSGAQ
ARFGGPTGLGTSAARLLQSLGAAVG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccattcgaattgccgaacttctacacaccgtatccggcgcggctgaacccg
catctggaagaggcccggaggcactcgaaggaatgggcccgcggcatggaaatgctggag
ggttcgggtatctgggaggagagcgatctcgaggcccatgactatgcgctgctgtgctcg
tacacgcatccggactgctccgcggaggcgctctcgctcgtcaccgactggtatgtctgg
gtcttcttcttcgacgaccacttcctggagagattcaaacggacactggaccgcgaaggc
ggcaaggaatatctcgaccggctcccggcctttatgccgatggacacggatacgcccgta
cccgagccgaccaaccccgtggaggccgggctggcggacctctgggcgcgcaccgttccg
gccatgtcgggggaatggcgggcgcggttccgcgaaagtaccgagaacctcctcaatgaa
tcgctctgggaactctccaacatcaacattcaccgggtgcccaatcccgtcgagtacatc
gaaatgcgccgcaaggtgggcggcgcaccgtggtccgcgggcctggtggaatacgcggcc
ggggcggaagtgccggccgccgtcgccgcttcgcggccgctgcgggtcctcaaggacacc
ttctccgacgccgtacatctgcggaacgacctcttctcctaccagcgggagacggaggac
gagggcgaactgagcaatggcgtactggtcctggagaccttcctgggctgtacgacgcaa
gaagccgcggacgccgtcaacgacctcatcacctcccgcctccagcagttcgaggacacc
gtgtgcggcgaactgccggtgctcttcgcggaaaggggcctggatccgcgggcctgcgcc
gacgtcctggcgtatgccaaggggctccaggactggcagtccggcggccatgaatggcat
atgaggtccagccgctatatgaacggcggcgggacggccgccacgagcggcaccgcctgg
tcgccgttcgccctcgacggtctcggcacctccgccgcggatctgaagtcctccctggcc
gcctccgagatccgccgtctgcgccgctacacccacaccccgcaccagaaggtcgggccg
tcgcgcatccccgacatccagatgccgttcaccgcgagcctcagcccccacctggacgcc
gcccgccgcaactgcatcgactgggcacaccggatgggcctgctcgagccgcagcccggc
gtcccgcactccggcatctgggacgaacgcgcgctcgccggatacgacttccccctgtgc
tcggccggcatcgacccggacgccacccccgaggaactcgatctgagctcccagtggctg
acctggggcacctacgccgacgactactatccggcggtcttcggccggaaccgcgacctg
gccggtgccagggcggccaacgcgcggctctcgtcgctgatgcccctcgacgcctcggcc
cccgccccctcgccggccaacgccatggaacgtgccctggccgacctgtggtcccgtacg
gcgggcccgatgaccccggaggcacgcagcgccttccgcgccgccgtcggcacgatgacg
gacagctggctctgggagctcgacaaccagctgcagaaccgtatccccgaccccgtcgac
tacatcgaaatgcgccgggccaccttcggctccgatctcacgatggccctgtgccggatc
ggccacggccggcagatcccggccgagatccaccgcaccgggaccctgcgctccctggag
aacgccgccgccgactacgcgatgctggtcaacgacgtcttctcgtaccagaaggagatc
gagtacgagggcgaggtccacaacggcatcctggtcgtccagaacttcttcgactgcgac
tacccgaccgcgctggccgtcatcaacgacctgatgacgtcccgtgtgcgggaattccag
catgtcgcggccaatgaactgcccgtcctctgcgacgacttcaagctctccgccgacagt
cgcgccgccctggacgcatacgtccgggaactggaggactggatgtccggcattctcgtc
tggcaccgcgactgccaccgctaccgggagtccttcctgcgccaccgctcgggggcgcag
gcccggttcggagggcccacgggactgggcacttcggccgcgcggctgctgcagtcgctc
ggcgctgcggtggggtag

DBGET integrated database retrieval system