KEGG   Streptomyces lydicus A02: T261_7214Help
Entry
T261_7214         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00230  Purine metabolism
sld00250  Alanine, aspartate and glutamate metabolism
sld01100  Metabolic pathways
Module
sld_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    T261_7214
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    T261_7214
Enzymes [BR:sld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     T261_7214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AJT68816
Position
7758110..7759480
Genome map
AA seq 456 aa AA seqDB search
MHTIVVDLGYGDAGKGTVVDRLCVRPPGAAPVAAVVRFNGGAQAAHNVVTTDGRHHTFAQ
FGSGTFSAVPTHLSRLMLVDPLALASEARHLAGLGVPDPLALLTVDRRALLTTPYHAAAN
QARERARGTARHGSCGMGIGETAAYALAHPADAPTAGDCTSRTALRRTLTLLRDRLTDEL
GPLGAPPVDACLDAFAAFAGHVRLVDGDHLARLLRSGPVVFEGAQGVLLDEWHGFHPYTT
WSTTTFAGAEDLLAEAGQPHSARRLGVVRTYTTRHGPGPLVTEDPSLPGVLPEAHNGHGR
WQGAFRAGHFDAPAHAYAVEVCGGVDALAVTHLDAPARHPGLRIVRGYRTADGGLMDRIP
AAAGPDDRDLIRQQRLTERLLTARPASWQSPGDDPRAWPDAIADVLSAPVALESYGPTAA
DKITDGALTAEGAHSTGHGRVIPQGSRSRCPERSPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaccatcgtggtcgatctcggctacggcgacgccggcaagggcaccgtcgtcgac
cggctctgcgtccgcccaccgggcgccgcgccggtcgcggcggtggtccgcttcaacggc
ggcgcccaggccgcccacaacgtcgtcaccaccgacggccgccatcacaccttcgcccag
ttcggctccggcaccttcagcgcggtccccacccacctctcccgtctgatgctggtcgac
cccctggcgctcgcctccgaggcccgccacctggccggcctcggcgtccccgacccgctc
gccctcctgaccgtggaccgccgcgccctgctcaccaccccgtaccacgcggccgccaac
caggcccgcgaacgcgcccgcggcaccgcccggcacggctcctgcggcatgggcatcggc
gaaaccgccgcctacgccctcgcgcaccccgccgacgccccgacggcgggcgactgcacc
tcccgtacggcgctgcgccgcacactcaccctgctccgcgaccggctgaccgacgaactc
ggcccgctcggtgccccgcccgtcgacgcctgcctggatgccttcgccgcgttcgccggc
catgtacggctcgtcgacggcgaccacctggcgcggctgctgcggtccggcccggtcgtc
ttcgagggcgcccagggcgtgctcctcgacgaatggcacggcttccacccgtacacgacc
tggtcgaccaccaccttcgccggggccgaggacctgctcgccgaggccgggcagccgcac
tcggcccggcgcctgggtgtcgtacgcacctacaccacccggcacgggcccggccccctc
gtcaccgaggacccgtcgctgccgggcgtcctccccgaggcccacaacggtcacggccgc
tggcagggcgccttccgggccgggcacttcgacgcgcccgcgcacgcctacgccgtcgag
gtctgcgggggagtggacgcactggccgtcacccatctcgacgccccggcgcgccacccc
gggctgcgcatcgtccgcggctaccgcaccgccgacggcggcctgatggaccgcatcccg
gccgccgccgggccggacgaccgggacctgatccgccaacagcggctcaccgaacggctg
ttgaccgcccgcccggcctcctggcagtcaccgggcgacgacccgcgcgcctggccggac
gccatcgccgacgtcctgtccgccccggtcgccctggagtcgtacggacccacggcagcc
gacaagatcactgatggggccctcaccgccgaaggggcacattccacgggacacgggagg
gtcattccacagggaagtcgaagtaggtgtccggaaaggtctccggcttga

DBGET integrated database retrieval system