KEGG   Streptomyces leeuwenhoekii: sle_26610Help
Entry
sle_26610         CDS       T04414                                 

Gene name
sle_26610
Definition
(GenBank) Fructose-1,6-bisphosphatase class 2
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00010  Glycolysis / Gluconeogenesis
sle00030  Pentose phosphate pathway
sle00051  Fructose and mannose metabolism
sle00680  Methane metabolism
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
sle01120  Microbial metabolism in diverse environments
sle01130  Biosynthesis of antibiotics
sle01200  Carbon metabolism
Module
sle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sle_26610 (sle_26610)
   00030 Pentose phosphate pathway
    sle_26610 (sle_26610)
   00051 Fructose and mannose metabolism
    sle_26610 (sle_26610)
  09102 Energy metabolism
   00680 Methane metabolism
    sle_26610 (sle_26610)
Enzymes [BR:sle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     sle_26610 (sle_26610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: CQR62122
UniProt: A0A0F7VX41
Position
chromosome:3223867..3224901
Genome map
AA seq 344 aa AA seqDB search
MTEHHHLPSELDVPSEAPDRNLAMELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTL
VHTVSMNGVVVIGEGEKDEAPMLFNGEHVGDGTGPECDIAVDPIDGTTLTAKGMPNAIAV
LAAAERGSMFDPSAVFYMDKLVTGPEAADFVDIDAPVAVNIRRVAKAKRSTPEDVTVCIL
DRPRHQELIDQVRQTGARIKLISDGDVAGSILALREGTGIDLLLGIGGTPEGIISACAVK
CLGGTIQGKLWPKDDEERQRAIDAGHDLDRVLTTDDLVASDNVFFAATGITDGELLRGVR
YRSETATTSSIVMRSKSGTVRRIDSEHRLSKLRAYSAIDFDRAK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcatcatctgccgtccgagctggacgtcccctccgaggcccccgaccgg
aacctcgccatggaactcgtccgcgtgaccgaggccgcggcgatggccgccggccgctgg
gtcgggcgcggcgacaagaacggcgccgacggtgccgcggtgcgcgccatgcggaccctc
gtccacaccgtgtcgatgaacggcgtcgtggtcatcggcgagggcgagaaggacgaggcc
ccgatgctcttcaacggggagcacgtcggagacgggaccgggcccgagtgcgacatcgcc
gtggacccgatcgacggcaccacgctgaccgccaagggcatgccgaacgcgatcgcggta
ctggccgccgccgagcgcggctcgatgttcgacccgtccgccgtcttctacatggacaag
ctggtcaccgggccggaggccgccgacttcgtcgacatcgacgcgccggtggcggtgaac
atccgccgtgtcgccaaggccaagcggtccacgcccgaggacgtcacggtctgcatcctg
gaccggccgcgccatcaggagctgatcgaccaggtccggcagaccggcgcccgcatcaag
ctgatctccgacggcgatgtcgccggctccatcctggcgctgcgcgagggcaccggtatc
gacctgctgctcggcatcggcggcacccccgagggcatcatttcggcctgtgccgtcaag
tgcctgggcggcaccatccagggcaagctgtggcccaaggacgacgaggagcggcagcgc
gcgatcgacgccgggcacgacctggaccgcgtgctgaccaccgacgacctggtcgccagc
gacaacgtcttcttcgccgcgaccggcatcaccgacggcgagctgctgcgcggggtgcgc
taccgctccgagaccgccacgacgtcctcgatcgtcatgcgctccaagtccggcacggtc
cgccggatcgactccgagcaccggctgagcaagctgcgcgcgtacagcgcgatcgacttc
gaccgggcgaagtaa

DBGET integrated database retrieval system