KEGG   Streptomyces leeuwenhoekii: sle_29590Help
Entry
sle_29590         CDS       T04414                                 

Gene name
sle_29590
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sle00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    sle_29590 (sle_29590)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sle03011]
    sle_29590 (sle_29590)
Ribosome [BR:sle03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    sle_29590 (sle_29590)
  Bacteria
    sle_29590 (sle_29590)
  Archaea
    sle_29590 (sle_29590)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CQR62420
UniProt: A0A0F7VRK5
Position
chromosome:complement(3547643..3547990)
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGLNATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHTDVDSLYVSEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgtgtg
gtggacctcatccgtggcctgaacgccacggaggctcaggcggtcctgcgtttcgccccg
caggccgcgagcgtgccggtcggcaaggtgctcgacagcgccatcgccaacgccgcgcac
aactacgaccacaccgacgtcgacagcctgtacgtctccgaggcgtacgtcgacgagggc
ccgaccctgaagcggttccgcccgcgtgcccagggccgcgcctaccggatccgcaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system