KEGG   Streptomyces leeuwenhoekii: sle_37970Help
Entry
sle_37970         CDS       T04414                                 

Gene name
sle_37970
Definition
(GenBank) Probable low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sle  Streptomyces leeuwenhoekii
Brite
KEGG Orthology (KO) [BR:sle00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    sle_37970 (sle_37970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: CQR63256
UniProt: A0A0F7W2L4
Position
chromosome:4493457..4494455
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIAVALFFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSG
VAKTVSEGLIETPEGSTGMGILFAALIGAIVWNLITWYFGLPSSSSHALFGGMVGAALAG
GTTVYWHGVVDKIVIPMFVSPVVGLLAGYLVMTAIMWIFRKSNPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEDYGDPIPVWVKIACALMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFTTAFLFHAPISTTHVITSAIMGVGATKRVNAVRWG
VAKNIILGWFITMPAAAAVAAVSFWIVNLAFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttcgctctggtcgtgaccatcgcggtcgcgctgttcttcacctacaccaac
ggcttccacgactccgccaacgccatcgccacctccgtgtcgacccgggcgctcacgccg
cgggcggcgctggcgatggcggccgtgatgaacctcgccggcgcgttcctcggctccggg
gtcgccaagaccgtcagtgagggcctcatcgagacgcccgagggctcgacggggatgggg
atcctcttcgccgcgctcatcggtgcgatcgtctggaacctgatcacctggtacttcggc
ctgccctcgtcctcctcccacgccctcttcggcggcatggtgggcgcggcgctggccggc
gggacgaccgtgtactggcacggcgtcgtggacaagatcgtcatccccatgttcgtgtca
ccggtcgtcggcctgctcgccggctacctggtcatgacggcgatcatgtggatcttccgg
aagtccaacccgcacaaggccaagcggggcttccgcatcgcgcagacggtgtcggcggcg
ggcatggcgctcggccacggtctgcaggacgcccagaagacgatgggcatcgtggtgatg
gcgctggtcatcgccgacgtcgaggactacggcgatcccatcccggtgtgggtgaagatc
gcctgcgccctgatgctgtcgctggggacgtacgccggtggctggcgcatcatgcggacg
ctgggccggaagatcatcgagctcgatccgccgcaggggttcgcggccgagacgacgggc
gcgtcgatcatgttcacgacggcgttcctcttccacgcgccgatctccacgacgcatgtc
atcacgtcggcgatcatgggcgtcggtgcgacgaagcgggtcaacgccgtgcgctggggc
gtcgcgaagaacatcatcctgggctggttcatcaccatgccggcggcggcggcggtggcc
gcggtgtcattctggatcgtgaacctggcgttcttgtag

DBGET integrated database retrieval system