KEGG   Streptomyces leeuwenhoekii: sle_45850
Entry
sle_45850         CDS       T04414                                 

Gene name
sle_45850
Definition
(GenBank) Hypothetical Protein sle_45850
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00525  Acarbose and validamycin biosynthesis
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    sle_45850 (sle_45850)
Enzymes [BR:sle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     sle_45850 (sle_45850)
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: CQR64043
UniProt: A0A0F7VZK6
Position
chromosome:complement(5392098..5392973)
AA seq 291 aa
MTAPGVPSAALADWRLPVRGAAAVELARRHGVRGLQFDLGGPGRGPWLDAPGRLARLARA
ARAAEVAPLAVTGNVLNDIGLTAPEGTLAAGRVRDVLRRVLDAAAELGAPLVFVPSFRRS
AIDGEGALRRTARVLRGAAAGAADRGLHLASENTLAPAAALRLVEEVGSPAFRLLLDTYN
PRAAGVDPAALVAMAGAWLADQVHAKDGPAGTDTTPLLGDGDGAVAATLDAVAAHGPAVR
ALVLENDHRSGDPARLDADLGRLRALATRLGRGRAATGAAPTTETKGTAGR
NT seq 876 nt   +upstreamnt  +downstreamnt
gtgaccgccccgggcgtgccgtcggcggcgctggccgactggcggctgcccgtacggggc
gcggcggcggtggagctcgcccgccggcacggggtgcggggactccagttcgatctgggc
gggcccggccgggggccgtggctggacgcgccgggccggctggcccggctggcccgcgcc
gcccgcgcggcggaggtcgcgccgctcgcggtcaccggcaacgtgctcaacgacatcggg
ctcaccgcgcccgagggcaccctcgccgccggccgggtgcgggacgtcctgcggcgggtg
ctggacgcggccgccgagctgggggcgccgctggtcttcgtccccagcttccggcgcagc
gcgatcgacggcgagggcgcgctgcgccgcaccgcccgggtgctgcgcggcgccgccgcc
ggtgcggcggaccgcgggctccacctggccagcgagaacaccctcgcgcccgcggcggcc
ctgcggctggtggaggaggtgggctcgcccgccttccggctgctgctggacacctacaac
ccccgcgccgcgggcgtggaccccgcggcgctggtggccatggccggcgcgtggctcgcc
gaccaggtgcacgccaaggacggcccggccggcacggacaccacgccgctgctcggcgac
ggggacggcgcggtcgccgccacgctcgacgcggtggccgcgcacggcccggccgtgcgg
gcgctggtgctggagaacgaccaccgctcgggcgaccccgcgcggctcgacgcggacctg
gggcggcttcgcgcactggccacgcggctgggccggggccgggccgcgacgggggcggcc
cccacgacggagacgaagggaacggcagggagatga

DBGET integrated database retrieval system