KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00379Help
Entry
SLGD_00379        CDS       T01177                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00020  Citrate cycle (TCA cycle)
slg00620  Pyruvate metabolism
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
Module
slg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLGD_00379
   00620 Pyruvate metabolism
    SLGD_00379
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SLGD_00379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo Polyketide_cyc K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADC86527
Position
416201..417700
Genome map
AA seq 499 aa AA seqDB search
MANSQPKDVILIGAGVLSTTFGSMLKELEPNWNIKLYERMDRPALESSNERHNAGTGHAA
LCELNYTVEQPDGSIDIEKAKEINEEFEISKQFWGHLVKSGSIDNPREFINPLPHISFVR
GVNNQKFLKKRYEAMKDFPMFDNIEYTEDIETLRKWVPLMMEGRVDDGKMAASKIDEGTD
VNFGELTRKMTKNIEAHPNAEVHFNHEVLDFNRLKDGKWEVKIRNRATGQVQTQVTDYVF
IGAGGAAIPLLQKTGIPESKHLGGFPITGQFLACTNPQVIEQHDAKVYGKEPPGTPPMTV
PHLDARYIDGQRTLLFGPFANVGPKFLKNGSNLDLFKSIKPHNITTMLAAAVKNLPLLKY
SFDQIIMTKEGCMNHLRTFYPEARDEDWELYTAGKRVQVIKDTKEHGKGFIQFGTEVVNS
QDHTVIALLGESPGASTSVSVALEVLERNFPEYADDWKPKVKEMIPSYGESLITDVDLMR
KTRRQTSKDLELGYYDDEK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcacaaccaaaagacgtcattttaattggcgctggtgtcttaagcactaca
tttggttctatgttaaaagagcttgaacctaactggaatatcaagctttatgaacgtatg
gaccgtcctgcacttgaaagttctaacgaacgacataatgctggtacaggtcatgcagca
ctatgtgaattgaactatactgttgaacaacctgatggttcaattgacattgaaaaagcg
aaagaaattaatgaggaattcgagatttctaaacagttttggggtcatttagttaaatca
ggtagcattgataacccaagagaatttattaacccactaccacatattagttttgttaga
ggcgttaataaccaaaaattcttgaaaaaacgttatgaagctatgaaagatttcccaatg
tttgataatatcgagtatacagaagatatagaaacattgagaaaatgggttccattaatg
atggaaggccgtgtcgatgacggtaaaatggctgcaagtaaaatcgacgaaggtactgac
gttaactttggtgagttaacacgtaaaatgactaaaaatatcgaagcacatccaaatgct
gaagttcactttaaccatgaagtgcttgatttcaatcgtcttaaagacggtaaatgggaa
gtgaaaattcgcaaccgtgctactggccaagtgcaaacacaagtgactgactatgtattt
attggcgcaggtggtgcagcgattccattattacaaaaaacaggtattcctgaaagcaaa
cacttaggtggattcccaattacaggtcaattcttagcttgtacaaatccacaagttatc
gagcaacatgatgccaaagtttatggtaaagagccaccaggcacaccaccaatgactgtg
ccgcatttagatgcgcgttatatcgatggtcaaagaacattgttatttggaccattcgct
aacgttggacctaaattcttgaaaaatggttctaatttagatttattcaaatctatcaag
ccacataacattacaacaatgttagcggctgccgttaaaaacttaccattacttaaatat
tcattcgatcaaattattatgactaaagaaggttgtatgaatcacttacgtacattctat
ccagaagcacgtgatgaagattgggaattatacactgctggtaaacgtgttcaagttatc
aaagatactaaagaacacggcaaaggatttattcaattcggtacagaagtggttaattca
caagaccatacagttattgctttacttggtgaatcaccaggggcatcaacatcagtatca
gttgcactagaagttcttgaaagaaacttcccagaatatgctgatgactggaaaccaaaa
gtaaaagaaatgattccttcttatggtgaatcattaattacagatgttgatttaatgaga
aaaacacgtcgtcaaacatctaaagaccttgaattaggttattatgatgatgaaaaataa

DBGET integrated database retrieval system