KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00492Help
Entry
SLGD_00492        CDS       T01177                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00010  Glycolysis / Gluconeogenesis
slg00030  Pentose phosphate pathway
slg00051  Fructose and mannose metabolism
slg00680  Methane metabolism
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
Module
slg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00492
   00030 Pentose phosphate pathway
    SLGD_00492
   00051 Fructose and mannose metabolism
    SLGD_00492
  Energy metabolism
   00680 Methane metabolism
    SLGD_00492
Enzymes [BR:slg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SLGD_00492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADC86640
Position
complement(545558..547522)
Genome map
AA seq 654 aa AA seqDB search
MTPNTLSELKQKYLDLLSHHYDSPEKLATEIINLESILELPKGTEHFVSDLHGEYDSFQH
VLRNGSGNVRAKINDIFKDKLTTKEINDLAALVYYPEEKLKLIKNEFNSRGQLNLWYITT
IERLIELITYCSSKYTRSKLRKALPTQYVYIVEELLYKSNEFNNKKSYYETLVNQIIELE
QSDDLIIGLSYTIQRLVVNHLHVVGDIYDRGPQPDKIMDTLIDYHSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEAYYDGNNPAFKPKKRPDKK
AALTKLEEDQITKIHQAIAIIQFKLEIPIIKRRPNFEMEERLVLEKTDYDNNKITVYGKT
YPLTNTCFTTVDPQNPGQLLPEEEDVINKLLLSFQQSEKLKRHMSFLMQKGTLYLPYNGN
LLIHGCIPVDENGEMEAFEIEGVKHQGRDLLDVFETHVREAFDHKDITDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIEDKVSHKEEKNPYYHLREDVDMIRKMLKDFGLNPDEGRI
INGHTPVKEIDGEDPIKADGKMLVIDGGFSKAYQKTTGIAGYTLLYNSFGMQLVAHQEFN
TKDKVLSDGADELSVRRVVDEELQRKKIRDTNDGYHIQEQIDILKTLMHDRYLN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgaatacactaagtgaacttaagcaaaagtatttagatttactttcccatcat
tacgatagcccagaaaaattagcaactgagattattaatttagagtctattttagaatta
ccaaaaggcacggaacactttgtcagtgatttacacggtgaatatgattcgttccaacat
gtattgcgcaatggttcaggcaacgtacgcgcgaaaataaatgatatctttaaagataaa
ttaaccactaaagaaattaatgatttagctgcccttgtttattatcccgaagaaaagtta
aagctaattaaaaatgaatttaattctagaggacaactcaatctgtggtatatcactacg
attgaacgcctaattgaacttattacatactgttcttctaaatatacacgttcaaaattg
cggaaagctttaccgacgcaatatgtctacattgttgaagaactattgtacaaaagcaat
gaatttaataacaaaaaatcttattatgaaacactcgtgaaccaaattattgaacttgaa
caatcagatgatttaattatcggtttatcttatacaattcaacgattagtcgtaaaccat
ctccatgttgttggtgacatttatgaccgtggacctcaaccagataaaattatggataca
cttatcgattatcattctgtcgatatccaatggggtaatcatgacgtattatggattggt
gcctatgccggttcaaaggtgtgtttagccaacttacttcgcatttgcgcgcgttatgat
aacttagatattatcgaagatgcatatggcattaatttacgaccgttactcactcttgcg
gaagcctattatgacgggaacaatcctgctttcaagcctaaaaaacggccggataaaaaa
gctgctttaacgaaactagaagaagatcaaataacaaaaatacatcaagcgattgccata
atccaattcaaattagaaatacctattattaaacgacgtccaaactttgaaatggaagag
cgtctcgtgcttgaaaaaacagattatgacaacaacaagattactgtgtatggtaagacc
tacccattaacaaatacgtgctttactactgtggatccacaaaatcctggtcaattgtta
cctgaagaagaagatgttattaataagctgttattgtcattccaacaatcagaaaaatta
aaacgtcatatgtcatttttaatgcaaaaaggtacattatatctcccttataacggtaat
ttactcatccatggctgtattcctgttgatgaaaatggagaaatggaagcttttgaaatt
gaaggtgtgaaacatcaaggacgtgatttactagatgtatttgaaacgcatgtacgtgaa
gcatttgaccataaggatattacagacgacttatctactgacctagtgtggtatttatgg
actggtaaatatagttcattatttggtaaacgtgccatgacaacatttgaacgttatttt
attgaagataaggtctcacataaagaagaaaagaacccttattatcacctacgtgaagat
gtggacatgattcgtaaaatgttaaaagactttggtctgaatcctgatgaaggacgtatt
atcaatgggcatacacctgttaaggaaattgatggagaagacccaattaaagctgatggt
aaaatgcttgtaattgatggtggtttctcaaaagcctatcaaaaaactacaggtattgct
ggctatacattattatacaattcattcggtatgcagcttgttgctcaccaagaatttaat
acgaaagataaagtactatctgatggggctgatgaactatctgtacgtcgagtcgtagat
gaagagctacaacgcaaaaaaatacgtgataccaatgatggttaccatattcaagaacaa
atcgatattctcaagacattaatgcatgatcgctatcttaattag

DBGET integrated database retrieval system