KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00777Help
Entry
SLGD_00777        CDS       T01177                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:slg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SLGD_00777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:slg03011]
    SLGD_00777
Ribosome [BR:slg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SLGD_00777
  Bacteria
    SLGD_00777
  Archaea
    SLGD_00777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: ADC86925
Position
838985..839338
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaactataagaatcgcacctcgtaaagttagattagtt
cttgacttaatcagaggtaaaaatgctgctgaagcaattgcaattttaaaattgacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagcaaatgctgaacac
aactatgatatgaacactgatgaattagttgttaaagaagcatatgctaatgaaggacca
actttaaaacgtttccgtccacgtgcacaaggccgtgcaagtgcaattaacaaacgtact
agccacatcactatcgtcgtaagtgacggaaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system