KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01506Help
Entry
SLGD_01506        CDS       T01177                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00020  Citrate cycle (TCA cycle)
slg00310  Lysine degradation
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
Module
slg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLGD_01506
  Amino acid metabolism
   00310 Lysine degradation
    SLGD_01506
Enzymes [BR:slg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLGD_01506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Macoilin
Motif
Other DBs
NCBI-ProteinID: ADC87597
Position
complement(1546762..1548072)
Genome map
AA seq 436 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEDAGVIQEQLA
NEGDTVEVGQAIAIVGEGSAEAKSAEASKSDGKAESKGESESETTTNTANEDTTRDHEQR
QDEAEKADRSDEVKKHTQRVNATPSARRHALKQGVDLAEVAGKSNDVVRKEDIDQRQQQS
SNKKAETAQRKAPETSSSSTPNKPVIREKMSRRKKTAANKLLEVSNNTAMLTTFNEVDMT
NVMELRKRKKEKFMQDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMIKKQYYDIG
IAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFG
SMMSTPIINGSQAAILGMHSIMTRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLK
TIKDLIENPEDLLLES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccggaattagcagaatcaattacagaggggaccattgcagaa
tggcttaaaaatgttggcgattctgttgaaaaaggagaagcaattttagaattagaaaca
gataaagttaatgtggaagttgtatcagaagatgcaggtgtgattcaagaacaacttgct
aatgaaggtgatactgttgaagtaggacaagccattgccattgttggagaaggtagtgct
gaagcgaaatcagcagaagcttcaaaatctgacggtaaggctgaatctaaaggtgagtcg
gagtcagaaacaactacaaatacagctaacgaagacacaactcgtgatcatgaacagcga
caagatgaagctgaaaaagcagatcgttctgacgaagtaaaaaaacatactcaacgtgta
aatgccacaccttcagcacgtcgtcatgctttaaaacaaggtgtagaccttgctgaagta
gcaggtaaatctaatgatgtcgtaagaaaagaagatattgatcaacgtcaacaacagtca
tcaaataaaaaagcagaaacggcacaaagaaaagcgccagaaacatcatcatcttcgaca
ccaaacaaaccagttattcgtgaaaaaatgtctcgtcgtaagaaaacagcagctaataaa
ttgcttgaagtatcaaataatacagcaatgttaacgacatttaatgaagttgatatgacg
aatgtgatggaattacgtaaacgtaaaaaagaaaaatttatgcaagatcatgatggtaca
aaattaggatttatgtcattcttcacaaaagcagcagtagccgcgttgaaaaaatatcca
gaagtcaatgctgaaattgatggagatgacatgatcaagaaacaatattatgatattggt
atagctgtatcaacagatgatggtttattagttccatttgtaagggactgtgataagaag
aattttgcagaaatcgaacaagaaattgctaatttagcagttaaagcgcgtgataaaaaa
ttaggcttagacgacatggtaaatggatcatttacaattactaacggtggtatcttcggt
tcaatgatgagtacgccaatcatcaatggtagtcaagcagcaatattaggtatgcattca
attatgacacgtccaattgcaattgataaagatacaattgaaaatcgaccaatgatgtat
attgctttaagctatgatcacagaattattgatggtaaagaagcagtaggtttcttgaaa
acaattaaagatctcattgaaaatccagaagatttattattagaatcataa

DBGET integrated database retrieval system