KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01667Help
Entry
SLGD_01667        CDS       T01177                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00071  Fatty acid degradation
slg00072  Synthesis and degradation of ketone bodies
slg00280  Valine, leucine and isoleucine degradation
slg00310  Lysine degradation
slg00362  Benzoate degradation
slg00380  Tryptophan metabolism
slg00620  Pyruvate metabolism
slg00630  Glyoxylate and dicarboxylate metabolism
slg00640  Propanoate metabolism
slg00650  Butanoate metabolism
slg00900  Terpenoid backbone biosynthesis
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
slg01212  Fatty acid metabolism
slg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLGD_01667
   00630 Glyoxylate and dicarboxylate metabolism
    SLGD_01667
   00640 Propanoate metabolism
    SLGD_01667
   00650 Butanoate metabolism
    SLGD_01667
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLGD_01667
   00072 Synthesis and degradation of ketone bodies
    SLGD_01667
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLGD_01667
   00310 Lysine degradation
    SLGD_01667
   00380 Tryptophan metabolism
    SLGD_01667
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLGD_01667
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLGD_01667
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SLGD_01667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slg04147]
    SLGD_01667
Enzymes [BR:slg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SLGD_01667
Exosome [BR:slg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLGD_01667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADC87758
Position
complement(1728176..1729321)
Genome map
AA seq 381 aa AA seqDB search
MREAVIVAAKRTAFGKYAGQLKHLEPEQLLLPLFQFYQNKYPNICGHIQDVIIGNTVGNG
GNVARKSLLTANLEYGIPGLTLDRQCGSGLESVIYACRMIQCGAGSVYLAGGVESTSRAP
WKIKRPQSVYDTNLPQFYERASFAPDNQDVSMIQAAENVAQHYHISRDEQDEFAFRSHQK
TASFYQNGKIKKEIVPIHSKGQTFAQDESLKPRLTPAKFSRFKPLLPGGTVTVGNSCMKN
DGAALILVLEKQLAKRFGFSEGLVFKQAVTKGVDPTMLGIGPVAAVQQLLTQTPFSINDI
NTFEINEAFSSQVLACQQQLHIPIDKLNIWGGAIATGHPYAASGAALITRLFNMEDKMTS
IATMGIGGGMGNAALLQREHF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgttattgttgcagccaaacgcacagcatttggtaagtatgcgggtcaa
cttaaacatttagaaccagaacaattattacttccactatttcaattttatcagaataaa
tatcccaatatatgtggtcatattcaggatgttatcattggtaatacagtagggaatgga
ggtaatgtggcacgtaaatcattgttgacggcaaatttagaatacggcatacctggttta
acattggatcgccaatgtggttcggggttggaaagtgtcatttatgcatgtcggatgatt
caatgtggtgcagggtcagtatatctagctggtggcgttgaaagtacaagtcgtgcgcct
tggaaaattaaaagacctcaatcagtttatgatactaacttacctcaattttatgagcgt
gcttcttttgcacctgataatcaagatgtttcaatgattcaagcggctgaaaatgtagcg
caacattatcatataagccgtgatgaacaagatgaatttgcttttcgcagtcatcagaag
actgcatccttttatcaaaacggtaaaattaagaaagagattgttccgattcactcaaaa
ggacaaacttttgcgcaagatgaaagtttaaaaccacgattaacaccagctaaatttagt
cgatttaagccacttttgccaggaggaacggtaactgtaggaaatagttgtatgaaaaat
gatggtgcagctttgatattggtcttagagaaacaactcgcaaaacgatttggatttagc
gaaggactcgtctttaagcaagctgtaacaaaaggtgttgatccaaccatgctaggcatt
ggtccagttgctgctgtccaacaattattaacacaaacgcctttttctataaatgatatt
aatacatttgaaattaatgaggcatttagttcacaggtattagcttgtcagcaacaatta
catatacctatagataaactcaatatttggggaggtgcgatagcgactggtcatccatac
gcagcgagtggtgcagcgctaataacacgcttatttaatatggaagataagatgacgagc
attgctacaatgggcattggaggaggaatgggtaatgcggccctcttacaacgagaacac
ttttaa

DBGET integrated database retrieval system