KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02502Help
Entry
SLGD_02502        CDS       T01177                                 

Definition
(GenBank) homocysteine-binding domain-containing 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00270  Cysteine and methionine metabolism
slg00670  One carbon pool by folate
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SLGD_02502
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SLGD_02502
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SLGD_02502
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     SLGD_02502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: ADC88566
Position
2579653..2581491
Genome map
AA seq 612 aa AA seqDB search
MSQFLNQLQNNILVADGAIGTILYSEGLDTCPEAYNLTHPDKVERIHRSYIEAGADVIQT
NTYGANFEKLKPFGLEHKVKEIHKAAVKIAKRAATKNTFILGTVGGFRGIKQDDISLSTI
QYHTENQIDTLIEEGVDALLFETYYDLDELKRIVTWTKRNYDIPVVAQLTASNTTYLVDG
TEINDALAQLVTCGADVVGLNCHHGPHHMEKSFSHIALPDNAYLSCYPNASLLDIENSEF
KYNDNAQYFGAVAEKLIEQGVRLIGGCCGTTPQHIHYIKSSVSHLSPVNHKKVIPIHKKS
NQRRTDSIKQSLTSKVKQGPTVIVELDTPKHLDTDLFFENIGKLDAAHIDAVTLADNSLA
TVRISNIAASSLIKQRYDIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSKV
GHLPGSTNVYDVNSKGLTELALRFNQGINTDGDALKKHTNFNIAGAFDPNVRKLDGAVKR
LEKKIASGMSYFITQPVYSKEKIIQVYEATKHLNIPIFIGIMPIASYNNALFLHNEVPGI
KMSESVLNQFKAVKDDKEKTKELSLRLSKDLIDTVHQYFNGLYIITPFQRVDYSLELAAY
SRSITTNKEAIL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatttctcaaccagttacaaaacaatatcttagtagctgatggcgctataggt
actattctttattcagaaggcttagatacttgcccagaagcctataacttaactcatcct
gataaagttgaacgaattcatcgctcatatatcgaggcaggcgccgatgttattcaaacc
aacacatatggtgctaattttgaaaaattaaaaccctttggtttagaacataaagttaaa
gaaattcataaggctgctgttaaaattgcaaagcgcgctgcgactaaaaatacatttata
ttaggtactgtaggcggatttcgcggtattaaacaagatgatatttctttatcaacgata
cagtatcatacggaaaatcaaattgatacgttgattgaagaaggtgtagatgcactgcta
tttgaaacatattacgacttagatgaattgaaacgtattgttacctggactaaacgtaat
tatgacattccggtagtcgcacaattaaccgcttcaaacacaacttatcttgttgacggt
acagaaatcaatgatgccttagcacaacttgttacttgtggtgctgatgtggttggcctg
aactgtcatcacggaccacatcatatggaaaaatcattttctcacatcgcattgccagat
aatgcatatctttcgtgttatcccaatgccagtttactagatattgaaaacagtgaattt
aaatataatgacaatgcacaatactttggtgctgtagcagaaaaattaatcgaacaaggt
gtacgcttgattgggggttgttgtggaacgacaccacaacacattcattacattaaatcc
tcggtgtcacacctctcacctgttaaccataaaaaggttattcctattcataaaaagagt
aatcagcgtcgaacagattcgataaaacaatcactaacttctaaagttaaacaaggccca
acggtaattgtcgaactagatactccaaagcacttggatacagatttattctttgaaaat
ataggaaaattggatgcagcacatattgatgctgtaacgttagcagataattcgctggcc
actgttcgcattagtaacatcgctgcttccagtctaattaaacagcgctatgacattgaa
cctttagtacatattacctgccgagaccgtaatttaattggcttacaatctcatttatta
ggcctatctttaataggtgtcaatgaaattttagctattactggagatccatctaaggta
ggacatttaccaggttcaacgaatgtctacgacgtcaactctaaaggtttaacagaatta
gctttacgttttaatcaaggtattaatacagacggtgatgcgctgaagaaacatactaac
ttcaacatcgctggcgctttcgatccaaacgtacgaaagttagatggcgctgtaaaacgc
ttagaaaagaaaatagcaagcggcatgagttatttcattacacaaccggtttatagcaaa
gaaaaaatcattcaagtgtatgaagcaacaaaacatctaaatatacctatatttatagga
attatgcctattgcaagttacaacaatgcactatttttacataatgaagtgccaggcatc
aagatgtcagaaagtgtattaaatcagtttaaagcagttaaagatgataaagaaaagacg
aaagaattgagtttaagactatcaaaagatttgattgatacagtacatcaatattttaac
ggattgtatatcatcacaccatttcaacgtgtagattactctctagaactcgcagcgtac
tcacgatcaatcaccactaataaggaggcaatattatga

DBGET integrated database retrieval system