KEGG   Sulfurovum lithotrophicum: YH65_05155Help
Entry
YH65_05155        CDS       T03877                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slh  Sulfurovum lithotrophicum
Pathway
slh00450  Selenocompound metabolism
slh00970  Aminoacyl-tRNA biosynthesis
slh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YH65_05155
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YH65_05155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slh01007]
    YH65_05155
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slh03016]
    YH65_05155
Enzymes [BR:slh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     YH65_05155
Amino acid related enzymes [BR:slh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YH65_05155
Transfer RNA biogenesis [BR:slh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YH65_05155
 Prokaryotic type
   Other AARSs
    YH65_05155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f NOB1_Zn_bind Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AKF24842
UniProt: A0A0F6WN83
Position
complement(1047552..1049501)
Genome map
AA seq 649 aa AA seqDB search
MSSSCHKAYITTPIYYVNDIAHIGHAYTTIIADTLARYSRMSGLDTFFLTGTDEHGQKIE
ESAKARGKTSQEYADEISATFKNLWDDFGISYDKFIRTTDADHMKGVQKAFKVMYDNGDI
YKDVYKGHYCISCETFFPESQLVDGEFCPECGKPTTIVEEESYFFKLSAYQDKLLAWYND
NPDCILPKSKRNEVIRFVEGGLEDLSITRTSFDWGVKLPEELNDPKHVMYVWLDALMNYV
TALGYGTDEAKMDFWPARVHLIGKDILRFHAIYWPAFLMSLGLEMPKHIAAHGWWTRDGE
KMSKSKGNVVNPREVADAYGLDNFRYFMLREVPFGGDGDFSQKALIDRINSDLGNDLGNL
LNRLIGMSGKYFEGRVDSANVSKYYQTELDEVSASLEKLEPLLFDMQIHRYLEELWRPLS
VANKAIDKYQPWTLMKEGREEEAMALNGLIANILAKVSVMLYPVMPVICPKIATALSFSI
DNASWHSLIKEKKLLETFTIEKIPPLFPRVEEPLLKQAIPEDTKTEKKKETKKEEKKDEG
VALIGIDQFFQTSLKVGTVVAAEEVPKSKKLLLLQVDIGEETPRQVVAGIKEWYSADDML
GTQVCVVANLKPAKLMGLKSEGMLLAAKDENGLCMIRPEKPKTPGTPIS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcttgccacaaagcatacatcaccacccccatctactatgtcaacgacatt
gcccacatcggtcatgcctacacaaccatcatcgcagacacacttgcgcgatactcccgc
atgagcggtctggatactttctttcttaccggaacggacgaacacggacagaaaatagag
gaatccgccaaagccagaggcaaaacgtcacaggagtatgcagacgagatctccgcgact
ttcaaaaatctttgggacgattttggtatctcctacgacaagttcatcagaacgaccgat
gcagaccatatgaaaggcgttcagaaagctttcaaggtcatgtacgacaacggtgacatc
tacaaagatgtctacaaaggccactactgtatctcctgtgagacctttttcccggagtct
cagctggtagacggtgaattctgtccggaatgcggcaaacccacaaccattgtggaagaa
gagagctatttctttaaactctctgcctaccaggacaaactgcttgcatggtacaacgac
aatcccgactgtatccttcctaaaagcaaacggaacgaagtgatccgttttgtcgaaggc
ggtcttgaagacctctccatcaccagaacctctttcgactggggtgtcaagcttcccgaa
gagctcaatgatcccaagcatgttatgtatgtatggcttgatgcactgatgaactatgtg
accgctctgggttacggtacagatgaggccaaaatggatttctggccggcacgtgtacac
cttataggaaaagacatcctgcgttttcatgctatctactggccggcattcctgatgagt
cttggccttgaaatgcccaagcacatcgcggcacacggctggtggacgcgtgacggagag
aagatgagcaagtccaaaggcaacgtcgtcaaccccagagaagtggcagatgcctacgga
ctggacaacttccgttacttcatgctgagagaagtccccttcggcggtgacggcgacttc
tcacagaaagcactcatcgaccgtatcaactccgatctgggaaatgacctgggcaacctg
ctcaaccgtctcatcggtatgagcggcaaatacttcgaaggcagggtagattctgccaat
gtgtccaaatactaccagaccgaactcgatgaagtatctgcttcactggaaaaacttgaa
ccgctgctttttgatatgcagatacaccgttatcttgaagaactctggagaccgctgagc
gttgccaacaaagctatcgacaaatatcagccatggacgctcatgaaagaaggcagagaa
gaggaagcaatggcactcaacggcctcattgcaaacatccttgccaaagtatcggtcatg
ctctaccctgtcatgccggtgatctgcccgaagatcgcaactgctctgagcttcagcatc
gacaatgcaagctggcacagtctgatcaaagagaagaaactgctggagacctttaccatc
gaaaagatcccgccactcttccctcgtgtcgaagaaccgctgcttaagcaggctattcct
gaagatacaaaaaccgaaaagaaaaaagagaccaaaaaagaggagaagaaggacgaaggt
gttgctctcataggcatcgaccagttcttccagacctcactgaaagttggtaccgttgta
gcggctgaagaggtacccaagagtaaaaaactgctcctgctccaggtcgacatcggtgaa
gagacgccgagacaggtcgtggcaggtatcaaagagtggtactctgcagacgacatgctg
ggcacacaggtttgtgtcgtagcaaaccttaaaccggctaagctcatgggcctaaaaagt
gaaggcatgcttcttgcggccaaagacgagaacggactgtgcatgatccgtcctgaaaaa
cctaaaacaccggggacaccgatcagctga

DBGET integrated database retrieval system