KEGG   Sulfurovum lithotrophicum: YH65_06220Help
Entry
YH65_06220        CDS       T03877                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slh  Sulfurovum lithotrophicum
Pathway
slh00071  Fatty acid degradation
slh00280  Valine, leucine and isoleucine degradation
slh00310  Lysine degradation
slh00362  Benzoate degradation
slh00380  Tryptophan metabolism
slh00620  Pyruvate metabolism
slh00630  Glyoxylate and dicarboxylate metabolism
slh00640  Propanoate metabolism
slh00650  Butanoate metabolism
slh00900  Terpenoid backbone biosynthesis
slh01100  Metabolic pathways
slh01110  Biosynthesis of secondary metabolites
slh01120  Microbial metabolism in diverse environments
slh01130  Biosynthesis of antibiotics
slh01200  Carbon metabolism
slh01212  Fatty acid metabolism
slh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YH65_06220
   00630 Glyoxylate and dicarboxylate metabolism
    YH65_06220
   00640 Propanoate metabolism
    YH65_06220
   00650 Butanoate metabolism
    YH65_06220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YH65_06220
   00072 Synthesis and degradation of ketone bodies
    YH65_06220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YH65_06220
   00310 Lysine degradation
    YH65_06220
   00380 Tryptophan metabolism
    YH65_06220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YH65_06220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YH65_06220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YH65_06220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slh04147]
    YH65_06220
Enzymes [BR:slh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YH65_06220
Exosome [BR:slh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YH65_06220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKF25032
UniProt: A0A0F6WND8
Position
complement(1271644..1272957)
Genome map
AA seq 437 aa AA seqDB search
MSTKKTKAQTERIAIITGLRTPMARAGGRFAKMQADRLGAVLFRELMMRSPVDVNEVDEV
IIGNVAQPIHAANIARVIALRAGFPEATPALTVHRNCASGMESITTAASRIHAGEGRVYV
CGGVESMSNIPLVYNKKMTSLFTKLAASKTLFDKLRTLMGFRPAYLKPIVGLMSGLTDPV
SGLLMGSTAEVLAQDFGISREEQDLFSLLSHQKAAKAKENGRFALESMPVVYDEYAGKYL
DYDDGIREGQTLEKLARLKPFFDRKNGTVTAGNSSQITDAAAGVVLMGESEAKKRGFEPL
GYLRDHAYSGLEPKRMGLGPVFSTHKLFAQTGLGMKDIEIMEINEAFAAQVIACERAFAS
KAFAKAHFGDRKAVGAIDPDILNVNGGAVALGHPVGMTGTRLVITVLHELRQRGLQRGLA
TLCIGGGQGASLLLEVE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaaaaaaacgaaagcacaaacggaacgtatcgcgatcataacaggactgcgt
acccccatggcaagagcgggcggacggtttgcgaagatgcaggcagaccggctgggtgcg
gtactgttccgtgaactgatgatgcgttctcccgttgatgtgaacgaggtggatgaggtc
atcataggtaatgtcgcacagcccatccatgcagcgaatattgcaagggtcatcgcactg
cgtgcgggttttcccgaagcgacccccgctttgaccgtacaccgaaactgtgcctcgggt
atggagtccatcaccacggcggcttcccggatccatgcgggagagggcagggtatatgtc
tgcggcggcgtggagtctatgtccaatattccactggtctataacaagaagatgacatca
ctgttcaccaaactggcagcatccaaaactctctttgacaaactgcgtaccctgatgggt
tttaggccggcttacctcaagccgatcgttggcctgatgtccgggctgaccgatccggtc
agtggactgttgatgggttctacggcagaagtcctggcgcaggatttcggtatcagcagg
gaggaacaggacctcttttctctgctgagccatcaaaaagcggcaaaggccaaagagaac
ggccgttttgcgctggagagtatgccggtcgtctatgatgagtatgccggaaagtatctg
gactatgacgacggtatacgcgaaggacagacattggaaaaactggcacgactgaagcct
ttcttcgaccgaaagaacggaacggtgacggcgggtaactcttcgcagatcacggatgca
gctgcgggcgtggtactgatgggcgagagtgaagccaaaaaaagaggttttgaacctctg
ggctacctgcgcgaccatgcctactccggacttgaacccaaacgcatggggctgggccct
gtcttttcgacacacaaactttttgcccagacaggtctaggtatgaaagatatcgaaatc
atggagatcaatgaagcctttgctgctcaagtcattgcctgtgaaagggcttttgcctcc
aaagcgttcgccaaagcgcattttggcgacagaaaagcggtcggtgccattgaccccgat
atcctgaatgtcaacggaggtgccgtagcactggggcatccagtcggaatgaccggaaca
aggttggtgatcactgtgctgcatgagctcagacagcgtggcctgcagcgcgggctggcg
actttgtgtatcggcggcgggcagggtgcttcactcttactggaggtggaataa

DBGET integrated database retrieval system