KEGG   Spirosoma linguale: Slin_0529Help
Entry
Slin_0529         CDS       T01156                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sli  Spirosoma linguale
Pathway
sli00010  Glycolysis / Gluconeogenesis
sli00020  Citrate cycle (TCA cycle)
sli00620  Pyruvate metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
Module
sli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_0529
   00020 Citrate cycle (TCA cycle)
    Slin_0529
   00620 Pyruvate metabolism
    Slin_0529
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Slin_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C HlyD_3 QRPTase_N GCV_H DUF2196
Motif
Other DBs
NCBI-GeneID: 8724257
NCBI-ProteinID: ADB36593
UniProt: D2QFB6
Position
649130..650890
Genome map
AA seq 586 aa AA seqDB search
MAELIRMPKMSDTMTEGVIAEWHKKVGDKVKSGDVLAEVETDKATMDLEAYDEGTLLYIG
VEKGASVPVDGVLAVIGADGEDYKAVLNGSSGGSQDAAPAAPKPEPAPAPANSASAEATT
KLPDEKAVSAAPAENVNASIIRMPKMSDTMTEGTIVAWHKKEGDTVKSGDVLAEVETDKA
TMDLEAYEEGTLLYIGVKEGSSVAVDEVIAVVGEKGANFKVLLDGGSGAPAAGQQAATGE
SGSATAQQNPQADLPANADSDLSYAGGEGDAVGSNGRVKASPLAKRIAEEKGINLAQVQG
TGPEGRIVKSDVESFVPGKAAPAAQPTAPAAQPVAQPAAPAPAAAPAPAPAPTPAATSVG
GDYEDIPVSQMRKTIARRLSESLFTAPHFYLTMEINMDKAMDLRGTVNGLSPVKVSFNDF
VIKAAALALKQHPNVNSSWLGDKIRKYKYVNIGVAVAVDEGLLVPVVRNADQKTLSTISG
EVKDLAGKAKDKKLQPKDWEGSTFSISNLGMFGIEEFTAIINPPDSCILAVGAIKQTVKF
EGEIAKPTNVMKVTLSCDHRVVDGATGSAFLQTFKQLLEDPMRMLV
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaatccgaatgcccaaaatgagcgacacaatgaccgaaggcgtcattgcg
gagtggcacaaaaaagtgggcgataaagtaaagtccggcgacgtactggccgaagttgaa
actgataaagcaaccatggacctcgaagcatacgacgaggggacattgctctacatcggt
gttgaaaaaggggcttcggtgccggtagatggcgttctggccgttattggagcggatggt
gaagattacaaagctgtactcaacggatcgagtggaggaagtcaggatgctgccccggcg
gctcccaagccagaaccggctcctgcacctgccaatagcgcgagtgctgaagcgacaaca
aaactgcccgatgagaaagctgtatctgcggctcccgccgagaatgtaaatgcgtcgatt
atccggatgcccaaaatgagcgataccatgacggaaggaaccatcgtggcgtggcacaaa
aaagaaggggataccgtaaaatcaggtgacgtactggccgaagtcgaaaccgacaaagcg
actatggatctcgaagcctatgaggaaggtacacttctctatatcggtgtaaaagaaggt
tcgtcggttgcggtcgatgaggtcattgccgtggtcggtgaaaaaggtgctaatttcaaa
gtactgcttgacggtggttcgggtgcgcccgcagcaggtcagcaggccgctaccggcgaa
agtggtagcgcaacggctcagcagaacccacaggcagatttacccgccaatgctgattcg
gatttgtcgtatgccggtggtgaaggcgatgctgtcgggtcgaatggcagggtgaaagcc
tcgccattagccaagcgtattgccgaagaaaaaggcatcaatctggcacaggtgcagggc
actggccccgaaggtcgtatcgtgaaaagcgatgtcgaatcgtttgtgcctggcaaagca
gctccggccgctcaaccaacggctccggctgcccagccagtggctcaaccagccgcaccg
gctcccgctgcagcgccagctccggcaccagcgccaaccccagccgcaacctccgttggg
ggagattacgaggatattccggttagccagatgcgcaaaaccattgctcgtcgtctgagc
gagagtctgtttactgctccgcacttctacctgaccatggaaattaacatggataaggcg
atggacctgcgcggtacggtgaatggacttagcccagtgaaagtatcgttcaatgatttc
gtgatcaaggcggctgccctggcgctgaaacaacacccgaatgttaactcgtcgtggtta
ggcgataaaatccggaagtacaagtacgtaaacattggcgttgcggtagccgttgatgaa
ggcttgcttgtacccgttgtacggaacgccgatcagaaaaccctgtcgacgatttcgggc
gaagtgaaagatctggccggaaaagccaaagacaaaaaacttcagccgaaagactgggaa
ggcagcacattctcgatttccaacctcggtatgtttggtatcgaagagtttacggccatc
atcaacccacccgattcatgcattctggccgttggtgccattaagcagactgtgaagttt
gaaggtgagatagctaaaccaacgaatgtgatgaaagtaaccctgtcctgcgaccaccgt
gtggtagacggtgctacgggctcggccttcctgcaaacgttcaagcaactgctcgaagat
ccgatgcggatgctggtataa

DBGET integrated database retrieval system