KEGG   Spirosoma linguale: Slin_0624Help
Entry
Slin_0624         CDS       T01156                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sli  Spirosoma linguale
Pathway
sli00052  Galactose metabolism
sli00511  Other glycan degradation
sli00600  Sphingolipid metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Slin_0624
  Lipid metabolism
   00600 Sphingolipid metabolism
    Slin_0624
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Slin_0624
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Slin_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 Malectin DUF4982 BetaGal_dom4_5 Malectin_like Big_3_5
Motif
Other DBs
NCBI-GeneID: 8724352
NCBI-ProteinID: ADB36688
UniProt: D2QG81
Position
784046..786730
Genome map
AA seq 894 aa AA seqDB search
MYARILFNTFLLTLLLQSGLHAQGRFSSTINSNWLFTKGDTAQKAVGSVWQTVSIPHTWN
TQDVLDDEPGYYRGDGWYKKTLYIPAGWKDREVYLYFEGAGQSADVFVNGKSVGKHQGGY
TFFSVPISSALRFAQSGNATNDVVVRVNNSVNENLPPIMGDYNIFGGLYRDVYLNVLDKV
HFDADNQATSGIFITTPQVNAASAVVQVKGSFVNGTGSSRNLIVSHRILTAEGAVLAEQK
KTVKANAGQKVDFVQDFKDIKGQRLWSPDDPYLYRVVSRITDAATGQKLDEVSNPLGFRW
YAFSASEGFSLNGNSLKLIGTSRHQDYPGMGNALPDAMHVRDVELLKEMGGNFLRVAHYP
QDPAVLQACDRLGILASVETPVMGFTDSEAFASSAKQQHREIIRQTYNHPSVIIWSYMNE
MLLRVPFATDSTKQQAYFRHLTDLARELEAMARQEDPARYTLIPNHGAFDLYNKVGLTKI
PRLVGWNLYQGWYGGTLEDFGKFLDMHHRELPDKPVLITEFGADADNRIHSFSPIRFDKS
VEYTMLFHQAYLKAILDRPFVAAGMIWNLTEFNTAVRAETLPNINPKGIMTYDRKEKDPY
RFYKANLLKAPYIQIGSKEWNRRVGTAESESQLTCSQPVVVFSNQPTVTLTVQGKVLGTA
ETKQGMARFTVPFVNGLNRLVATVSGSTVVSDQADIMFRVLPPTLKNPQLPFDELNVSLG
DSRFFFDEKTGQNWLPEQVYKPGSWGYVGGKQYVMKNNSRVSFGSGRNILGTELDPIYQT
QRTGIEQFKFDVPTGDYELVLHFAELISKTVNNDIAFNLGQRAVPEVYIERSFDVLINGQ
EVISGLSNSDVLKTDQPVATKFMVSVQNQEGITVSFNVRQGETVLNGIQLKKIR
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctagaattttatttaacacgttcctgctaaccctgcttctgcagtctggttta
catgcgcagggtcgcttttcgtcgaccatcaacagcaattggctgtttactaagggcgat
acggcccaaaaggcagttggcagtgtatggcaaacggtgtccattccgcacacctggaat
acgcaggatgtgctcgatgatgagccggggtactaccggggcgacggctggtataaaaaa
acgctctacataccggcaggctggaaagaccgggaggtgtacctgtattttgaaggcgcg
gggcagtcggccgacgtatttgtcaatggtaaatctgtcggaaaacatcagggcggatac
accttcttttccgttcccatcagcagcgccctgcgctttgctcagtcgggaaatgcaacc
aacgatgtggtggttcgggtcaataacagtgtcaatgagaacctgccacccattatgggc
gactacaatatattcggcggactctaccgggatgtttacctgaatgtactggataaggtt
cacttcgatgccgataaccaggcgacgagtggtatttttattaccaccccgcaagtaaat
gctgccagcgccgtggtacaggtaaaagggagcttcgttaatggtaccggcagcagccgg
aacctgattgtcagccatcgaatcctgacggcggaaggtgccgttttggcggagcaaaag
aagacagtaaaggcgaatgccgggcagaaagtcgactttgtgcaggacttcaaagacatt
aaagggcaacggctgtggtcgccggacgatccttacctttaccgggtcgtgtcgcgtatt
accgacgcggctaccggacagaagctcgacgaggtctctaatccccttggtttccgctgg
tatgcgttcagcgccagcgaaggcttttccctgaatggcaactctctgaagctgatagga
acgagccgtcaccaggactatcccggtatgggcaatgccctgcccgatgccatgcatgta
cgcgatgtggaactgctcaaagaaatgggcggcaatttcctgcgggtggcgcactatcct
caggacccggccgtactacaagcctgcgaccggctgggtattctggcgtcggtagaaacg
ccggttatgggttttaccgattcggaggcttttgccagcagtgccaaacagcaacaccgc
gaaattatccggcagacctacaatcaccccagcgtcattatctggtcgtatatgaacgaa
atgctgcttagagtgccctttgccactgattcgacaaagcaacaggcctacttccggcac
ctgaccgatctggcccgtgagctggaagctatggcccggcaggaagacccggctcgctat
acgctgatcccgaatcacggcgcttttgacctgtacaacaaagttgggctgacgaaaata
ccccggctggtgggctggaacctgtatcagggctggtacggtggtaccctggaggacttc
ggcaagttcctcgacatgcatcatcgtgaactgcctgataagccggtgctcattaccgag
ttcggggccgacgccgataaccgtatccatagcttcagcccgatccggttcgataaatcg
gtagagtacaccatgctgtttcatcaggcctatctgaaggcaatccttgaccggcccttc
gtagccgccggtatgatctggaacctgaccgagtttaacaccgccgtacgggccgaaacc
ttgcccaacataaacccgaaggggattatgacgtacgatcggaaggagaaagacccgtac
cgattttataaagccaacctgctgaaagctccgtacattcagattggctccaaagagtgg
aaccgtcgcgtgggaactgccgaatcggaaagtcagcttacgtgtagccagccggttgta
gtgttcagcaatcagccaaccgttacgctgactgtacagggcaaagtgctgggcactgcg
gagaccaaacagggaatggcccgctttacggttccgttcgtcaatggcctcaaccggctt
gttgctacggtatccggtagtacggtggtttccgatcaggccgatattatgtttcgtgtg
ttgccgccaaccctgaaaaaccctcagcttcccttcgacgagttaaatgttagtctgggc
gattcgcgcttcttcttcgacgaaaaaaccggtcagaactggctacccgagcaggtctac
aagcccggcagctggggctacgttggcggcaaacaatacgtcatgaaaaacaactcccgg
gtaagttttggcagtggccgcaacatactgggaaccgagctggacccaatctaccagacg
cagcggacaggcatcgagcagtttaaattcgatgtgcctaccggagactacgagctggtg
ctgcacttcgccgaactgatatcgaaaacggttaataatgacatcgccttcaacctgggg
cagcgggccgttcccgaagtgtacatcgaacgcagtttcgatgtgctgattaacggacag
gaagtaatttccggactcagcaacagcgatgtactaaaaaccgatcagcccgtggccacc
aagttcatggtaagtgtgcagaatcaggaaggcatcacggttagcttcaatgtccggcag
ggcgaaacggtcctgaatggcattcaacttaaaaagatccgctga

DBGET integrated database retrieval system