KEGG   Spirosoma linguale: Slin_2894Help
Entry
Slin_2894         CDS       T01156                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sli  Spirosoma linguale
Pathway
sli00010  Glycolysis / Gluconeogenesis
sli00620  Pyruvate metabolism
sli00640  Propanoate metabolism
sli00680  Methane metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_2894
   00620 Pyruvate metabolism
    Slin_2894
   00640 Propanoate metabolism
    Slin_2894
  Energy metabolism
   00680 Methane metabolism
    Slin_2894
Enzymes [BR:sli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Slin_2894
Lipid biosynthesis proteins [BR:sli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Slin_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 8726645
NCBI-ProteinID: ADB38907
UniProt: D2QK81
Position
3495853..3497748
Genome map
AA seq 631 aa AA seqDB search
MRIRTFNEYQEAYKHSVEDPESFWAEIAQEFQWRKPWTKTLQWNFDEPNVKWFTGGKLNI
TENCLDRHLLTQGDQPAIIWEPNDPNEASITLTYRMLHDQVCRFANVLKRNGVVKGDRVC
IYMPMVPELAIAVLACARIGAVHSVVFGGFSAQSIADRINDAQCKVVVTADGAYRGNKEI
PLKSTVDDALIGCPSVRKVIVLTRTRTPVSMLKGRDIWWEQELKQVTADCPAEEMDAEDM
LFILYTSGSTGKPKGVVHTCGGYMVYAAYTFQNVFQYEPGDIHFCTADIGWITGHSYIVY
GPLACGATSIIFEGTPTYPDYGRFWDITDKHKVNILYTAPTAIRSLMGFGLDKVENHDLS
SLRVLGSVGEPINEEAWHWYDDHIGKNRCPIVDTWWQTETGGILISPLASITKTKPTYAT
LPLPGIQPILVDENGKEIEGNGVSGNLCMKFPWPGILRTTYGDHERCRQTYFATYPGLYF
TGDGCLRDEDGYYRITGRVDDVLNVSGHRIGTAEVENAINMHTGVVESAVVGYPHDIKGQ
GIYAYVITDQQPSDHDADLTKRDILATVTRVIGPIAKPDKIQFVTGLPKTRSGKIMRRIL
RKIAEGDTSNLGDTTTLLDPAVVDEIKEGAL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccgaacctttaacgagtaccaggaagcctacaagcacagtgtagaagaccct
gaatctttctgggccgaaattgctcaggaatttcaatggcgtaaaccctggaccaaaaca
ctgcaatggaatttcgatgaacccaacgtgaagtggttcaccggaggcaaactcaacatt
acggaaaactgtctcgatcgtcacctgcttacccagggcgatcaacctgctattatctgg
gaacccaacgaccctaatgaagcaagtattaccctgacttaccggatgctccacgaccag
gtgtgccgattcgccaatgtgctgaaacgcaatggcgtagttaaaggcgaccgggtttgt
atttatatgccgatggtgcccgaactggctattgccgttctggcctgcgcccgtatcggg
gccgttcattcggtggtttttggcggtttttcggcacaaagtattgccgaccggattaat
gacgcccagtgcaaagtggtcgttacggccgatggagcttaccggggcaacaaggaaatt
ccgctcaaaagcacggtcgacgatgccctgatcggctgcccgagcgtacgaaaagtgatt
gttctgacccgtacccgtaccccggtatccatgcttaaaggccgcgacatctggtgggaa
caggagctaaagcaggtcaccgccgattgccctgccgaggaaatggacgccgaagatatg
ctcttcatcctctacacctccggctcaacgggcaagccaaaaggcgttgtgcacacctgt
ggtgggtacatggtctacgcagcctacacgttccagaatgtgttccagtacgagcccggc
gatattcacttctgcacggccgatattggctggattaccggacatagctacattgtatac
ggcccactggcctgcggagccacgtccataatttttgaaggaacgccgacctatccggat
tacggccgcttctgggacataacagacaaacataaagtcaacattctgtacacggcacca
acggccattcggtcgctgatgggcttcgggctggataaagtagaaaaccacgacctgagc
agcttacgggtgctcggttccgtgggcgaacccatcaacgaagaagcctggcactggtac
gacgatcatatcggtaaaaaccgatgccctattgtcgatacctggtggcagaccgaaacg
ggtggtattctgatttcacctttggccagtatcactaaaacaaaaccaacctacgcaacc
cttcccctgccgggtattcagccgattctggtcgatgaaaacggtaaggagatcgaagga
aacggtgtgagcggcaatctgtgcatgaagtttccgtggccgggcattttacggacgacc
tacggcgaccacgaacgctgccgacaaacgtattttgctacttatccgggtttgtatttt
acaggcgatggctgtctgcgcgatgaagatggctattaccggattacaggtcgcgtggat
gatgtactcaacgtatccgggcaccgcattggtacggccgaagtcgaaaacgccatcaac
atgcacacgggcgtggttgaaagcgcagtcgttggttacccgcacgacatcaaaggacag
ggtatctacgcctatgttatcaccgatcagcaaccgtccgaccacgacgccgacctgacc
aaacgggatattctggctacggtaacgcgggttatcggtccgattgccaagcccgataaa
attcagtttgtgacgggcctacccaaaacgcgttccggcaaaataatgcgccgtatcctc
cgtaaaatcgccgaaggcgacaccagtaatttgggcgatacgaccactctgctcgaccca
gcggtagttgacgagattaaggagggggcgctgtaa

DBGET integrated database retrieval system