KEGG   Spirosoma linguale: Slin_3323Help
Entry
Slin_3323         CDS       T01156                                 

Definition
(GenBank) alpha/beta hydrolase fold-3 protein domain-containing protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Abhydrolase_6 Chlorophyllase2 PAF-AH_p_II Esterase_phd Hydrolase_4 Chlorophyllase Lipase_3 Eno-Rase_NADH_b Esterase DUF2235
Motif
Other DBs
NCBI-GeneID: 8727076
NCBI-ProteinID: ADB39334
UniProt: D2QNE5
Position
complement(4020681..4021622)
Genome map
AA seq 313 aa AA seqDB search
MFAPTLPDTSMPRIFNMFIIRLLWQIPTGLFLVVVLFLSINEYAAARPSRRIKDIPYVAT
NASGTDAERHLLDVYTPRKATSAGKMPVVMFIHGGSWNSGSKNLYTFIGRRLAKQGVVAV
IINYRLSPAVLVPAMADDCAEAVRWTTQHIAEYGGDPDRIFVMGHSAGAGLAALLATDSR
LFAKLGITKNPVKGAILDDPAGLDMFDYLTRMEYPNDEQYLISYGKDPAVWRSVSPMYFV
SDATPHMLLYTGGRTYPSITSSSQRFIERLKEHNVKYDYKVLPGKKHVAMVTQLFWQHNL
IYQELLTFVGADK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcacctacactacctgacacctccatgccgaggatttttaacatgttcattatt
cgcctgctctggcaaattccaacaggactttttcttgtcgttgttctcttcttgtctatc
aacgaatatgctgccgcccggcccagtcggcgcataaaagatattccttatgtagccaca
aatgcttccggcaccgatgcagagcggcatttgctggatgtgtacacgccccgaaaagca
acgtctgcgggcaaaatgccggtggtcatgttcattcacggggggagctggaatagcggc
agtaaaaatctgtacacgtttatcgggcgtcgactggcgaaacagggtgttgtggcggtg
attatcaactaccggctctcgcccgctgtgctggtgcctgccatggccgacgattgtgcg
gaggctgttcgctggactacgcaacacatcgccgaatacggtggagatcctgaccgtatt
ttcgtgatgggccactcggcgggtgcgggactggccgccctgctggctaccgacagtcgg
ttatttgctaagctgggtataaccaaaaatcctgtgaagggggccattcttgatgatccc
gccggactggatatgttcgattacctcaccagaatggagtatccgaatgatgagcagtac
ctgatttcctatgggaaagacccggctgtctggcgtagcgtgtcgcccatgtattttgtc
agcgatgccacaccgcatatgctgctgtataccggtggccgtacctacccgagcattacg
agcagttcccaacgttttatcgaacggctgaaagagcataacgtgaaatacgactataag
gtattaccggggaagaaacacgttgctatggtgacgcaactgttctggcagcacaatctt
atttatcaggaactgctgacgtttgtaggcgctgataaatga

DBGET integrated database retrieval system