KEGG   Spirosoma linguale: Slin_3324Help
Entry
Slin_3324         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4440 SnoaL_2 SnoaL_3 SnoaL_4 SnoaL
Motif
Other DBs
NCBI-GeneID: 8727077
NCBI-ProteinID: ADB39335
UniProt: D2QNE6
Position
complement(4021701..4022156)
Genome map
AA seq 151 aa AA seqDB search
MKSFLGILIVSVLLTACSPSGDAVNVQDLNRQFIDAWNNKNADKITSLMADDVDFLQGNV
HYKGKSEVSQKWVQATLPTLANLKTNVISSASDTHTAYEAGTFAVDVLTNLPDQPRAFGE
GNFMLLWKKGDDGTWKLSYAQLEDLPVQAKN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttttcttggaatactcatcgtttccgtgctgttgacagcttgttcaccatcg
ggcgatgctgttaacgttcaggacctcaaccggcagtttatcgacgcctggaataacaag
aacgcggataaaataacgtcactcatggccgatgatgtggattttcttcagggaaatgtc
cattataaaggtaagtcggaggtgagccagaaatgggttcaggctacgttacctacgttg
gcgaacctgaaaacgaacgtgatcagctcggcttccgatacgcacactgcttatgaagca
ggtaccttcgccgttgatgtgctaactaatttgcccgaccagccccgtgcctttggcgaa
ggaaacttcatgctcctctggaagaaaggggatgatggaacctggaagctcagctacgca
caattagaggatttgcccgtacaggccaaaaattag

DBGET integrated database retrieval system