KEGG   Spirosoma linguale: Slin_3325Help
Entry
Slin_3325         CDS       T01156                                 

Definition
(GenBank) 17 kDa surface antigen
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly-zipper_YMGG Rick_17kDa_Anti Gly-zipper_Omp Wzy_C
Motif
Other DBs
NCBI-GeneID: 8727078
NCBI-ProteinID: ADB39336
UniProt: D2QNE7
Position
complement(4022258..4022950)
Genome map
AA seq 230 aa AA seqDB search
MRTIQHTAIALILVGILGQSMETKAQGLAPQTKGAAIGAGVGAAAGAIINKRNRAVGGVI
GGLAGGAGGYVIGKNGKKRWSPQAKGTAIGAGVGGAAGAIINKRNRVVGGVIGGVAGGAA
GYAIGKIKDNKNKEAARVAAANRATAEERAAAERRAAERAAGHTGTADSKPMVASAPAKG
TNKKAVQPVAMLAANPTTPAYMMNAGFLENETYGDPSAPYGTSEYRRKSW
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgattcaacatacggccattgctctgatactcgttggtatccttggccagtcg
atggaaacaaaagcacagggcctggccccgcaaacgaaaggtgccgctattggtgccggt
gttggggcagccgcaggcgctattatcaacaaacgaaatcgcgccgttgggggtgtcatc
ggcgggcttgccggtggtgccggtgggtatgtcattggcaagaacggtaaaaagcggtgg
agcccacaggcaaaaggcacggcgattggtgccggggtaggtggcgcggctggcgccatt
attaacaaacggaaccgggttgtgggaggtgttattggtggcgtagcaggtggagccgcc
gggtatgccatcggtaaaattaaagataacaaaaataaagaagcggctcgtgtcgctgcc
gccaaccgggcaactgccgaggagcgtgctgctgccgaacgaagagcagctgaaagagcg
gccggacataccggaaccgccgatagcaagcccatggtggcttctgccccggccaaagga
acgaataagaaagccgttcagccggtagccatgctggccgccaacccaaccacgcccgcc
tacatgatgaacgccgggttcctcgaaaacgaaacttacggcgacccttccgctccctac
ggaacctcggagtacagacgtaaaagctggtaa

DBGET integrated database retrieval system