KEGG   Spirosoma linguale: Slin_3334Help
Entry
Slin_3334         CDS       T01156                                 

Definition
(GenBank) beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
sli  Spirosoma linguale
Pathway
sli00311  Penicillin and cephalosporin biosynthesis
sli01130  Biosynthesis of antibiotics
sli01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Slin_3334
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    Slin_3334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sli01504]
    Slin_3334
Enzymes [BR:sli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     Slin_3334
Antimicrobial resistance genes [BR:sli01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    Slin_3334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Peptidase_S11 Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 8727087
NCBI-ProteinID: ADB39344
UniProt: D2QNF5
Position
4032276..4033325
Genome map
AA seq 349 aa AA seqDB search
MTLTPAKFTSLLVGLLLVLNLSGLAQTNTAGKKDLATQRLEQELNRIAAIAKAKVGICAL
HLESGKQVSLNLQERFPMASTVKVAIAVQLFTLIEQGKLSLMTMVDLQPSDLHPGSGTLE
VLFAKPGVQLSVQNLLELMMVISDNSATDILLRLVGGTEAVQNRLKTLGIQGMSVDRTII
QLIADLEGITLPPSDKWTVGFYAKLDSTTTPETRRAAAARLKTDPRDTSTPDAMVNLLAQ
IYRGTALKPESRALLLGVMERCRGGAARLKGYLPPNTIIAHKTGSLDGSATDDVGIITLP
GDAGHIAIAVFVGDSPMPLAEREQTIAHAARSIYDFFLYQPVSSSNTGR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaactcccgctaaattcacttctcttctcgttggccttcttctggtactgaat
ctatcaggtctggcccaaacgaacaccgctggtaaaaaagacctggctacacagcggctg
gagcaggaactgaatcgtattgcggcaatcgccaaagccaaagtaggcatctgtgctctg
cacctcgaatcggggaagcaggtgagtttaaaccttcaggagcgatttccgatggcgagt
accgtgaaggttgctattgcggtgcaactgttcacgctgatcgaacagggtaaactgtcg
ctaatgacgatggtcgatctgcaaccgtctgatctgcatccgggtagcggtacactcgaa
gtactatttgccaaacccggcgttcagctgtccgtgcagaatttgctggaattgatgatg
gtcatcagcgacaactccgccaccgatattctgctccggctggtgggcggtaccgaagcc
gttcaaaatcgtttgaaaacgctgggcattcaggggatgtcggtcgaccgcacaattatc
cagttgatcgccgatctcgaaggcattacgctacccccttccgacaaatggacggttggc
ttttatgctaaactggatagcaccacgacgccggaaacaagacgagccgcagcagcccga
ctcaaaacggacccacgcgatacctcaacacccgacgctatggtgaacctgttggcccaa
atttaccggggcacagccctcaaacccgaaagccgggcgctgctgctgggtgtcatggaa
cgctgccggggtggagccgcccgcctgaaaggttacttacccccaaacacgatcattgct
cataaaacaggttcgctggatggcagcgccaccgacgacgtaggcatcattacactgccg
ggcgatgcgggccatatcgccattgccgtttttgtgggtgattcgcccatgccgctcgcc
gaacgggaacagaccatcgcccacgcggcccgatccatttatgatttcttcctgtatcag
ccagttagttcatcgaacacaggtcgatag

DBGET integrated database retrieval system