KEGG   Spirosoma linguale: Slin_3345Help
Entry
Slin_3345         CDS       T01156                                 

Definition
(GenBank) amidase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8727098
NCBI-ProteinID: ADB39355
UniProt: D2QNG6
Position
complement(4044737..4046317)
Genome map
AA seq 526 aa AA seqDB search
MKKYVVSLFLIYSVVIASVCGQSFNAKTIPEATVTSLHAAMQAGKLTAVQLLQLYLDRIE
AYDKQGPYLNAIIMVNPKALAEARRLDSLYKATGKMVGPLHGIPVIVKDNYDTFDMPTTN
GTLAMKKSIPPDDAFVVRKIREAGAIIIAKSNLAEFAYSGQFSVSSILPGYSRNPYDTKR
TTAGSSGGTAAAVTANFGAIGLGTDTGSSIRGPASHQSLVGFRPTLGLVSRDGIAPLAMT
NDTGGPICRTVEDAVRVLDVIAGYDKADTVTKRSAGKIPQTYRQFLDKDGLKGARIGVFR
QMVMPKNSDPQVYALFNKALDELRAAGAIVIDSVRVPQLDTINKSFDTIPQLRRDFNLYL
ASLGPNAPHKTLESIVKSRQFHPYLEKGLLDAIADTLAPEAHKGWGKNLALRERLRQLLL
RAMDSTQVDALVYPSFSYPPRLIGDLNTPSGTNNNALSPPTGFPAFSVPMGFTYDVLPAG
LQFFGRPFSEPTLIKLAYAYEQATHHRRPPESTPALPKKKRKTMVQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatacgtagtttctctttttcttatttatagtgttgtgattgcgtcggtttgt
gggcagtctttcaatgccaaaaccatccccgaagccaccgtcaccagcttacatgccgcc
atgcaggccggtaaactgaccgccgttcaactgctacaactgtatctggaccggattgag
gcctacgacaaacaagggccttacctgaacgccatcatcatggtaaaccctaaagccctg
gccgaagcccggcggctggattcactctacaaagcaactggcaagatggttggcccgctg
cacggcattcccgtaatcgtgaaagataattacgacaccttcgacatgcccactaccaac
ggcacactggccatgaagaagtccattccacccgatgatgcctttgtggttcgcaaaatt
cgggaggccggggccatcattattgccaagtcgaatctggcggagtttgcctactcgggg
cagttttcggtaagctctattttgcccggctattcccgaaacccctacgacaccaaacgg
acaacggccgggtcgagtgggggcacggcggctgcggttaccgctaatttcggcgctatc
ggcctgggaacagatacgggcagctccattcgcggacccgcgtcgcaccagagtctggtt
ggtttccggccaacgctgggtctggttagccgggatggcattgcacccctggccatgacc
aacgataccggcggacccatctgccggacggtggaagatgccgttcgggtgctcgatgta
attgctggttacgacaaagcggataccgtaacgaagcgcagtgcgggtaaaattccgcaa
acctaccggcagtttctggataaagatgggctgaaaggagcgcggattggggtgtttcgc
cagatggtcatgcccaagaattcagacccgcaggtgtacgctcttttcaacaaagccctt
gacgaacttcgggctgcgggggccattgtgatcgattcagttcgggtgccccaactcgat
acgatcaacaaatcgttcgataccattccgcaattacggcgcgacttcaatttgtatctg
gccagtctgggacccaatgcaccgcataaaacgctggagtctattgttaaatcacgtcag
tttcacccctatctggaaaaagggctgctcgatgccatcgccgatacgctggcaccggaa
gcgcacaaaggctgggggaagaatctggccttgcgggagcggctccgtcagttgctgctt
cgggctatggattcgacgcaagtcgatgcactcgtgtatccgtcgttcagctacccgccc
cggctcatcggcgatctgaatacgccctcgggaacaaataacaatgccttgtcgccaccg
acggggtttccggctttttcggtaccgatgggatttacgtatgatgtactgcctgccggg
ttgcagtttttcggcagaccgtttagcgaaccaaccctgatcaaactggcctatgcctat
gagcaggccacccaccaccgccgaccgccggagagtacgcccgcgcttccgaagaaaaaa
cgcaaaacgatggtgcagtag

DBGET integrated database retrieval system