KEGG   Spirosoma linguale: Slin_3369Help
Entry
Slin_3369         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8727122
NCBI-ProteinID: ADB39377
UniProt: D2QP69
Position
4071333..4071566
Genome map
AA seq 77 aa AA seqDB search
MCYQSPFVPDKSRTPNQSGTAYNYVRGSDTGTSPHLTPWPVNLQPSDLITSKIRVGLLYI
HRFDPDVTIQYIVTFGL
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgtgttaccaatcacctttcgttcccgataagagccggaccccgaaccaatcaggaacg
gcttataactacgtcagggggtcagatacgggaacatccccgcatctgaccccctggcct
gtgaatttacaaccctcggatttaattacgtcaaaaatccgtgttggactgctttatatc
catcggtttgatccagatgttacgatacagtacatcgtgaccttcggcctgtaa

DBGET integrated database retrieval system