KEGG   Spirosoma linguale: Slin_3380Help
Entry
Slin_3380         CDS       T01156                                 

Definition
(GenBank) ATPase AAA
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_12 AAA_11 AAA_30 Viral_helicase1 AAA_19 DUF2075 ResIII Helicase_RecD UvrD_C_2 PhoH AAA_22 UvrD-helicase AAA_16 Herpes_ori_bp DEAD AAA_25 UvrD_C T2SSE ATPase_2 OmpH DAP3 AAA SRP54 AAA_14 AAA_24 AAA_5 AAA_33 HEM4 AAA_18 cobW Flavi_DEAD ABC_tran NTPase_1
Motif
Other DBs
NCBI-GeneID: 8727133
NCBI-ProteinID: ADB39388
UniProt: D2QP80
Position
4083557..4085455
Genome map
AA seq 632 aa AA seqDB search
MDYFKNLLDLLKVEREEDRTQYRKLTETTSIAERRANGLTWYPIAIRGSEMSRGDYVSVE
VERTTHQDIPHQLRFGMPAVLFSNHDPRTDRVEGTISHQSGNRLRITLRVDELPDWSRDG
KLGVEVLFDDNSYDEMEAALKLANSLAEKSDNRLINVLTGSTSPTFHPDTPPLSLPRLNP
SQVAAVGKILTANELAIVHGPPGTGKTTTLVQAIKALHKQDNKKLLVVAPSNTAVDLLSE
KLHDEGLSVLRVGNPARVSERLMALTLDHKVADHPAMKEARKLKKQANEFKNMAHKYKRN
FGKAERDQRKALFDEAHRIMKEVGNTEQYVIDDLVGKAQVITATLVGANHYTVRNLTYHT
VVIDEAGQALEPACWIPILKAQKVVLAGDHCQLSPTIKSAEAARKGLSHTLLEKCIKLHP
EAVSLLDEQYRMHEHIMGYSSQVFYKNKLKAHGSVARHSLFDSDTALVFVDTAGCGFDEK
LDGTSSTNPEEAALLMKHLTQLVTDLSTRYTKENFPTIAIISPYKQQINVLKDQLLHTPE
LQPYSDRISVNTIDSFQGQERDIVYISMTRSNAEGEIGFLSDIRRMNVAMTRARKKLVIV
GDSATLAGLPFYADFIAYAEQLNAYQSAWEFM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggattatttcaaaaatctgcttgatttactaaaggttgaacgagaagaagaccgtacc
caataccgcaaactcaccgaaacaacttctattgccgagcgtcgggccaatggcttgacc
tggtaccccattgccatccggggttccgaaatgagccggggcgattatgtatccgtagaa
gtcgagcggaccacccaccaggatattccgcaccagttgcggtttggtatgcccgccgtg
ctgttcagcaaccacgaccccaggactgatcgtgtggaaggtacgatctcccaccagagc
ggcaaccgcctgcgaataaccctgcgcgtggacgaactgcccgactggtcgagggatggc
aaactgggcgttgaagtactctttgacgacaacagttacgatgagatggaagcggccctc
aaactggccaattccctcgccgagaaatctgacaatcgcctgatcaacgtactgacgggc
tccacatcgccgacctttcaccccgatacgccacccttatcgcttccccggctgaacccc
agccaggtagccgccgtgggcaaaatattgacggctaacgaactggccattgtacatggc
cctcccggcacgggcaaaaccaccacgctggtgcaggccataaaagccctgcataaacag
gataacaagaagctgctggtcgttgcgcccagcaatacagctgtcgacttactgagtgaa
aagctgcatgacgaagggctgagcgtgcttcgagtgggtaatccggcccgcgtatcggag
cgattgatggcccttacgctcgatcataaagtggccgaccacccggccatgaaagaggcc
aggaagctaaagaagcaggccaacgagttcaagaacatggcgcataaatacaagcgaaac
ttcggtaaagcggagcgtgaccagcgtaaagccctgttcgacgaggcccatcggattatg
aaggaggtgggcaatacggagcagtacgtcatcgatgatctggtaggaaaagcgcaggtg
attacggcaacgctggtaggtgccaatcattacacagtccgtaacctcacgtatcatacg
gtggtcatcgacgaagccggtcaggcattggaaccggcttgctggattcccattctcaaa
gcacagaaagtggtgctggccggtgatcattgtcagctttcgcccactatcaaatcggct
gaagctgcccgcaaggggttgagccataccctgctcgaaaaatgcattaagttgcatcct
gaggccgtttctctgctggacgaacaataccggatgcacgaacacatcatggggtattcg
tcgcaggtgttttataagaacaagctgaaagcgcacggctcggtagcgcggcactcgtta
ttcgacagcgatacggctttggtgtttgtggatacggccgggtgcggtttcgatgagaaa
ctggatggcaccagttcaaccaatcccgaagaagccgccctgctgatgaaacacctaacc
caactggtcacggacctgagtacgcgctacacgaaagagaatttcccgactatcgccatt
atctcgccctacaagcagcagataaacgtactaaaagaccagttgctgcacacacccgaa
ttacagccttacagcgaccggatttcggttaacaccatcgacagttttcaggggcaggag
cgcgacatcgtgtacatctccatgacccgcagcaatgccgaaggggaaattggtttcctg
tccgacattcgccggatgaacgtcgccatgacccgcgcccgcaagaaactggtcatcgtt
ggcgacagtgcaacgctggcggggcttcctttctacgcggatttcatcgcctacgctgag
caattgaacgcttaccaaagcgcctgggagtttatgtga

DBGET integrated database retrieval system