KEGG   Spirosoma linguale: Slin_3382Help
Entry
Slin_3382         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Epimerase NAD_binding_4 DapB_N Semialdhyde_dh Sacchrp_dh_NADP Cohesin_HEAT Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 8727135
NCBI-ProteinID: ADB39390
UniProt: D2QP82
Position
4087131..4087793
Genome map
AA seq 220 aa AA seqDB search
MKIKAIITGATGMVGEGVLHECLQQPEVEAVLLINRNPSGVSHPKVSEIIHKDFFDLSSI
ESQLSGYNACFFCLGVSSVGMKEDEYRHLTYDLTLHVAETLARLNPDMTFGYISGAGTDS
TEQGRSMWARVKGATENALMRLPFKKAYMFRPGFMKPTPGLKNTLVYYKYINWLYPIGRA
LYPAGFSTLQELALAMIKSVSVGYEKSILEVKDIVDLAKR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaagcaattataaccggtgctacgggcatggtaggcgaaggcgtcctgcac
gaatgtttacagcaacccgaggtagaagcggtactgctcatcaaccgcaaccccagtggt
gtatcgcacccaaaagtcagcgagattattcacaaagatttcttcgatctgtcgtccatc
gaatcgcaactgagcgggtacaacgcctgctttttctgcctgggggtatcgtcggtagga
atgaaggaggacgaataccggcacctgacctacgacctgacgctacacgtagccgaaacg
ctggcccggctcaatcccgatatgacctttggttatatctcgggcgcaggaaccgacagc
accgaacagggacgcagcatgtgggcgcgggtgaaaggtgctaccgagaatgccctgatg
cggctgccgttcaagaaagcgtatatgtttcggccgggcttcatgaaaccaacccccggt
ctgaaaaacacgctggtctattataaatacatcaactggctgtatcctatcggccgggcg
ctttacccggcgggcttttcaaccttgcaggaactggcgctggccatgataaagtcggtc
agtgttggctatgaaaagtcaattctggaagtaaaggatattgtcgatctggcaaagcgg
tag

DBGET integrated database retrieval system