KEGG   Spirosoma linguale: Slin_3393Help
Entry
Slin_3393         CDS       T01156                                 

Definition
(GenBank) alpha-N-arabinofuranosidase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 8727146
NCBI-ProteinID: ADB39401
UniProt: D2QP93
Position
4101109..4102161
Genome map
AA seq 350 aa AA seqDB search
MKNYLFILLALVIACQSADKPNPTPTPPVTSVDTVGKFQNPLLTAAPDPWVTYKDGFYYV
MHTTGNDLRIYKTAAMSRLGSARPVTVWTPPTTGPNSRDIWAPELHFVNGKWYIYYAADN
NGNDATHRMFVLENESADPTQGTWVDRGQLNLPENRWAIDGTLLQQNGQLYFAWSGWQTD
QGGSQHIYMAKLSNPYTVESTARIRLSSPDYAWEKNGFGVNEGPEFLVHNNKVFLIYSAS
FCGTDLYALGQLSADTSADLLNPASWTKSATPVFGPNGGNGTFGVGHNSFFTTPDGKENW
LVYHANAASGQGCGNNRSIRMQPFTWKADGSPDFGSAAPIAQWIKRPGGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattatctgtttatactgctggcgctggtgatcgcctgccagtcggctgacaag
ccaaaccccacgcctaccccacccgtcacgtcggtcgacacggtcggcaagttccagaat
ccgttgctcaccgcagctcccgacccctgggtgacgtataaagatggcttctattacgtg
atgcacaccaccggaaacgatctgcgcatctataaaacagccgccatgagtcgtctgggt
tcggcacgtccggtaaccgtctggacaccgcccaccaccggccccaactcccgcgacatc
tgggcaccggaactccacttcgtcaacggcaaatggtacatctactacgctgccgacaac
aacggcaacgacgcgacccaccgcatgtttgtgctagaaaacgaatccgccgacccgaca
cagggaacgtgggtcgaccgggggcagctcaatttacccgaaaaccgatgggcaattgac
ggtacactacttcagcaaaatggtcagttgtatttcgcctggtcgggttggcaaacggat
cagggcggttcacagcacatttacatggccaaactatcgaatccgtacaccgtcgaaagt
acggctcgaattcgcctgtcatcgcctgattatgcctgggagaaaaacggttttggcgtg
aatgaaggccccgagtttctggtgcataacaacaaagtctttctgatttattcggccagc
ttctgcggaacggatctgtacgcactgggccagctctccgccgataccagcgcagatttg
ctcaacccggcatcctggacgaaatcagctacgccagtttttggtcccaacggcggcaac
ggcacctttggcgtgggtcacaacagttttttcactacccccgacggaaaggaaaactgg
ctcgtttaccacgctaatgccgcttcaggacagggctgtggcaataaccgctccatccgc
atgcagccttttacgtggaaagccgacgggtcgcccgattttggcagtgcagctccaata
gcgcaatggattaagcggcctggtggcgagtga

DBGET integrated database retrieval system