KEGG   Spirosoma linguale: Slin_3416Help
Entry
Slin_3416         CDS       T01156                                 

Definition
(GenBank) hypothetical protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC FixS
Motif
Other DBs
NCBI-GeneID: 8727169
NCBI-ProteinID: ADB39424
UniProt: D2QPB6
Position
complement(4137210..4137608)
Genome map
AA seq 132 aa AA seqDB search
MQRAQLKEFYGYGLILAVLTTVQMYSIYVATTTDLILTWKHYVGFGATALAGILWAFRKP
QYLFYALGLTLVLGYENLIGFTPTLDFTATRYYFNNMAFPVSYQDFSMYMLLIWAYVAHA
RLRTMVQSLLVK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgctcaattaaaagagttttacggctatggactcattctggccgtactgaca
accgttcagatgtattcaatttacgtcgcaacgacgacggatttgattctcacctggaag
cattacgtaggctttggcgcaacggcgctggctggtattttatgggcgttccgaaagccg
caatatctgttctacgcgctcggactaacgctcgtgctggggtatgaaaacctcatcggt
tttacgcctacactcgatttcaccgcaacccggtactactttaacaacatggccttcccg
gtatcctatcaggatttctctatgtacatgctgctcatctgggcatacgtagcccacgca
cgtctgcggacaatggtgcagtcgttgttagtgaagtaa

DBGET integrated database retrieval system