KEGG   Spirosoma linguale: Slin_3418Help
Entry
Slin_3418         CDS       T01156                                 

Definition
(GenBank) TonB-dependent receptor plug
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug CarbopepD_reg_2 CarboxypepD_reg
Motif
Other DBs
NCBI-GeneID: 8727171
NCBI-ProteinID: ADB39426
UniProt: D2QPB8
Position
4139187..4142417
Genome map
AA seq 1076 aa AA seqDB search
MKKHLPPQSLLGRLVSVVITQLLLTAMCVNFTYAKVPLALKTVADQRAITADRTLTGRVT
DEKDEALPGVSVILKGTQRGTVTDADGRYKVDVPTGGATLVFSFVGYVPQEVRVGNQTSL
NISLKADSKVLDEIVVIGYGTAKKSDLTGAVTSVKEAQLQERPTSSLNQALSGRMPGVQV
NTNSGRPGGRTTVRIRGFSSINSSNNPLYVVDGVMLPQGTGDQFSNPIDYINPNDIVNVE
VLKDASSTAIYGARGANGVILVSTRKGKAGESRVTYDGQFSVNTIGPNKPKVLNAKEYLA
TEDLAYANMAKYDPVGWAAGKWSYLDPIARRKAFSAAHPGVFDANLNPLYDTDWFKESAQ
NKLSQNHQLGFSGGNERTQYSLSLNYRDDQGLIKTSYMKRYSGRFSIDDQVKSWLKIGGT
LSYNNQTENLVDINDAVARQIVEDFPFLPVRYPDTGVFAENRDYPYAEGTMSSVHRLMDR
KYIQNTQTTLGSLFTNITLGKGLEMRTVLGANVQTQEINQSQTRTLNIGGNGNASTNNNK
TSFWSLEHYLTYNKQFGQDHSFTGLLGLSWQETNTFGIGASVSGFATDYFGFNNLGAGAT
NPSVSSSASRFAFNSYFGRINYGYKNKYLFTATGRADGSSKFGENYKFAFFPSAALAWRV
SEEDFLKGNPVISNLKVRASYGLTGNSEIPPYQSLSLLSSNYSTIYNDGRVGGTGISRLA
NPDLRWEKTAQTDVGLEVSFLKGRISLEADYYYRLTTDMLLDAPVPQSSGYATIRRNVGS
MENKGFEFGLNTVNINRGTFSWNTNFNISLNRNKVLSLATPSDIFGVGGPNFTNQTNIIR
IGESVGSFWGLTRVGVWSEAEREEAAKFTSYRNGLTILPGDIKYLDVNGDKAITDADRSI
IGNGSPKGWGAMTNNIRLGNFDATLELQYMFGNDVMLMNLHPSEDRQALANSYSSVLNAW
TPTNQGSQIAQVRDTRAGYVTNVDSHWIKNGSFLRGRNLLFGYTFPVEMTNKLKMNRLRM
YVSAQNFFLSVEDPIVGDPEVTPTNQGSGSSAFSQGQIWHNYPKPTTYMLGLQIGL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacttacctcctcaaagcctgctgggcaggttagtcagcgtagtaattact
cagctactactgactgcaatgtgcgttaattttacttatgccaaggtccctctggcatta
aaaacagtggccgaccaacgtgccattacagctgatcgtacactcacgggtcgggtgaca
gatgaaaaagatgaagccttacccggtgtgagtgttatcctgaagggaacccagcgcgga
accgtaaccgatgccgatggccggtataaagtggatgttcccacgggtggcgctacgctt
gtgttctcctttgtcggatatgtccctcaggaagtacgcgttggcaaccaaacctcactc
aatatcagcctgaaagccgacagcaaagtgctcgacgaaatcgtcgtgatcgggtatggt
accgccaaaaagtctgaccttaccggcgctgtcaccagcgtgaaggaggctcagcttcag
gaacggcctacatcctcattgaaccaggccctgtcaggtcgcatgcccggcgtgcaggtc
aacaccaactcgggacgacccggcggtcggaccaccgtccgtatccggggcttcagctcc
atcaactcctccaacaaccccctctacgtcgttgatggcgtcatgcttccccaaggtacc
ggcgaccagttcagtaacccaatcgattacatcaaccccaacgacatcgttaacgtagag
gtcctgaaagatgcctcttcgacggccatctacggagcacgcggtgccaacggcgttatt
ctggtctccactagaaaggggaaggccggtgaaagccgggttacctacgacggtcagttc
agcgttaacaccatcggacccaacaagccaaaggtgctcaacgccaaggagtacctggct
accgaagacctcgcctatgccaacatggccaagtatgaccccgtcggctgggccgcaggt
aagtggtcttacctggacccgatagcccggcgcaaagccttcagcgcggctcaccctggt
gtgtttgatgccaacctgaacccactctacgacaccgactggttcaaggagtcggctcag
aacaagctttcccagaaccaccagttaggtttcagtggcggtaacgagcgcacccagtac
tccctctcgctgaactatcgcgacgatcagggtctgatcaagacctcctacatgaagcgt
tactcgggtcgtttctcgatcgatgatcaggtcaagagctggctcaagatcggtggtaca
ctgagttataataaccagacggaaaacctggtggacatcaacgatgcggtggcccgtcag
atcgtggaggacttccccttcctacccgtgcgctacccggacactggcgtcttcgccgag
aaccgggactacccctatgcagaaggcaccatgagttcggtgcaccgcctgatggaccgt
aagtacatccagaacacccagaccactttgggtagcctcttcaccaacatcacgttaggc
aaagggctggagatgcgtacggtattgggtgccaacgttcagacgcaggagatcaaccag
tcgcaaacccgtacgcttaacatcggcggtaacggtaacgcatcgaccaacaacaataag
acctcgttctggtcgctggaacattacctgacctacaacaaacagtttggtcaggaccac
tccttcaccggactgctgggtctttcgtggcaggagactaacacctttggcatcggtgcc
agtgtgagcggttttgccaccgactactttggcttcaacaacctgggtgctggtgctacc
aacccatcggtgagttcaagcgcatcacggtttgcctttaactcctacttcggtcggatc
aactacggctacaagaacaagtacctcttcacggctaccggccgggccgatggctcctcg
aagttcggagagaattacaagtttgccttcttcccctcggcggctctggcctggcgggta
tcggaagaagacttcctgaagggcaatcccgttatctcgaatttgaaggtccgcgccagc
tacggcttgacgggtaactctgaaattccaccgtatcagtcactgtcgttgcttagctcg
aactattcgacgatctacaacgacggccgcgttggtggtacgggtatcagccgtttggct
aaccccgacctgcgctgggaaaaaaccgctcagactgatgtaggtctggaagttagcttc
ctcaaaggacgcatctcgctggaagccgactactactaccgtctgacaaccgacatgctc
ctggatgcccccgtaccacaatcgagcggctatgcaaccatccggcgtaacgtaggctcg
atggagaacaaaggcttcgagttcggtttgaacacggtcaacatcaaccggggtactttc
agctggaatacaaacttcaacatctcgttgaaccgcaacaaagtcctctccctggctact
ccatccgatatttttggggtaggtggtcctaacttcaccaaccagacgaatatcattcgt
attggtgaatcagtaggttcgttctggggtctgacccgcgtgggtgtatggagtgaagcg
gagcgggaagaagcggccaagttcaccagctaccgcaacggtttgaccattctgcccggc
gacatcaagtatctcgacgtaaacggcgacaaggccatcaccgatgctgaccgcagcatc
attggcaacggtagtcctaaaggctggggtgccatgaccaacaacattcgtctgggcaac
ttcgatgccaccctggaacttcagtacatgtttggtaacgacgtcatgctgatgaactta
caccccagtgaagaccggcaggctctggccaacagctactcgtcggtgctcaacgcctgg
acgccaaccaatcagggtagccagattgctcaggtacgcgacacacgggcgggctacgta
accaacgtcgacagccactggatcaagaatggttcgttcctgcggggtcgtaacctgcta
ttcggttacaccttcccggttgagatgactaacaagcttaagatgaaccgtctgcggatg
tatgtgtcggctcagaacttcttcctgtcagttgaagaccccatcgtaggtgatccggaa
gtaacgcccaccaaccagggctcaggcagcagtgccttctcacaaggtcaaatctggcat
aactaccccaaaccaaccacgtacatgctgggcctccagattggcttgtaa

DBGET integrated database retrieval system