KEGG   Spirosoma linguale: Slin_3421Help
Entry
Slin_3421         CDS       T01156                                 

Definition
(GenBank) RagB/SusD domain-containing protein
  KO
K21572  starch-binding outer membrane protein, SusD/RagB family
Organism
sli  Spirosoma linguale
Brite
KEGG Orthology (KO) [BR:sli00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sli02000]
    Slin_3421
Transporters [BR:sli02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   Slin_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SusD_RagB SusD-like_3 SusD-like_2
Motif
Other DBs
NCBI-GeneID: 8727174
NCBI-ProteinID: ADB39429
UniProt: D2QPC1
Position
4147753..4149318
Genome map
AA seq 521 aa AA seqDB search
MRHTFAKHISRVLLCGVALTGPIGCTEFLKEQAPSNLTTSSFYTIPDHAEAALASVYASL
RFMGDGAGIFSSNWQLLEALTGTSTTETAQNSDLNNLYSLVHDGNTAHVVNYWNGLYRVI
ANANQVLDRVPAITPMDAAQKTKILGETRFLRATAYFTAVQLWGDIPLITTPQTAASTDF
LPARASKEDVYKLIVDDLLAAEASGLAWMDVSGRANLAAVKTQLAKVYLTMAGFPLSKGA
PYYKLAADKALEVITYANANPSVINLFTTYEDVHRESTKNRVEHLFMLQYNTLVAGNPMD
NFYPNFKPVTYNGPGGTGSSVPTTAFYNSYEPGDLRTKDQVGYFYTTYYTNGNGAPFSLG
APYVFKHFNRTANGTAGVAGSRQNNLNVPQIRYAETLLIYAEAQNEVGGPTQAAYDAFKR
IRDRATLTTPALGTYTQASFREAVWRERWHELCYEQITWFDMVRLRKVYNEKTNGFDNFV
GHINLSSNQALQEKHLLLPIPKQELLNNPNLKTQNPGYPGV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagacatacatttgcaaaacacatcagtcgggtcctactgtgtggcgtagccctgaca
ggccccattggctgtaccgaattcctcaaggaacaggccccgtcgaacctgacgacatca
agcttttataccatccccgaccatgccgaagcggctctggcgtcggtctacgccagcctt
cggttcatgggcgatggagcgggtatcttctccagcaactggcagttgctggaagccctg
accggtacctccaccacggaaaccgcccagaactccgacctcaataacctgtatagcctg
gtacacgatggcaatacggcccacgtggtcaactactggaatggtctctaccgggtcatt
gccaacgccaatcaggtactggatcgagttcccgccatcacaccgatggatgccgcgcag
aagaccaagattctgggtgaaacccggttcctgcgggctaccgcttactttacggctgtt
caattgtggggcgatattcctctgattacgacgccccagacggcggcatcgacggatttt
ctccccgcaagggcatctaaagaagatgtttataaactgattgtcgatgacctgttagcc
gctgaagcttcgggactggcttggatggatgtaagtggtcgggccaatctggctgcggtg
aagacccagctcgccaaggtctatctgaccatggccgggttccccctcagcaaaggcgcg
ccttactataaactggccgctgataaggcccttgaggtgatcacctacgccaatgccaac
ccatcggtgatcaacctcttcaccacctacgaagatgttcaccgggaaagcaccaagaac
cgcgttgagcaccttttcatgctccagtacaatacgctggtagcagggaacccgatggac
aacttctatcccaacttcaaacccgttacttacaatgggccagggggaacgggtagctca
gtgccaacaacggcattttacaactcctacgagccgggcgatctgcggaccaaggatcag
gtggggtatttctacaccacctactataccaacggtaacggagcccctttctcgctgggt
gccccctacgtcttcaagcacttcaaccgcaccgccaatggtacggcaggggtggctggc
tcgcgtcagaataacctcaatgtaccccagatccgctatgctgaaacgctgctgatctat
gctgaagcacagaacgaagtaggtggccctacccaggcggcttacgatgccttcaaacgg
attcgggaccgggctacgctaaccaccccggcgctgggtacctacactcaggccagcttc
cgggaagccgtatggcgggagcgttggcatgagctgtgttacgagcagatcacctggttc
gatatggttcgtttgcggaaagtctacaacgagaagaccaacggcttcgacaactttgtg
ggtcacatcaacctaagctcgaatcaggctttgcaggagaagcatttgctgctgcctatt
cccaagcaggagttgctgaacaaccccaatctgaagacccagaacccagggtatccaggc
gtttaa

DBGET integrated database retrieval system