KEGG   Spirosoma linguale: Slin_3423Help
Entry
Slin_3423         CDS       T01156                                 

Definition
(GenBank) major facilitator superfamily protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 8727176
NCBI-ProteinID: ADB39431
UniProt: D2QPC3
Position
4150299..4151507
Genome map
AA seq 402 aa AA seqDB search
MNTTASLNKPNRNLFIQNLLTFFLNRQALAVGLVFASDSILFGSWVAHIPFVKAKLHLSD
AELGLTLFAMPIGLLVMNPLTGWIIARLGEARACFWSAVGLTLAVCIPLNAPNPIVLCLG
LFLMGLNAALINVAMNTTATNLERAQGIVIMSSCHGMWSLGGLFGSGIAGAVIALHVSPP
IHIMIMAGLILLMTFILQPILAKIPSSSRTETGEKAGSSFVRPNLDLLLMILIGLSLAMG
EGAAFDWSAVYLRETLGASSQIAALGFGAFSLTMTGFRFLGDAIIPKIGAKRWLQIGGVI
GAAGLLFAIALPYPATALIGFGVLGAGCSLGAPVLYAASMRVEGIPPAAGLATFATFSFI
GFLAGPPIIGFVAEAFGLVYGLGFVAIMLLISAGLAKLVKLF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacagcctctctgaataaaccaaatcgaaacctgttcattcaaaacctgctg
acgttctttctgaaccggcaggcgctggccgttgggctggtctttgcttccgatagtatt
ctgttcggcagttgggttgcccacattccgtttgtcaaagccaaactccatctttctgat
gctgaactgggactaacgctgtttgccatgcccattggtttactggtcatgaatccgcta
accggctggattattgcccggcttggtgaagcccgcgcctgtttctggtcggcggtaggt
ttgacattagccgtttgcatcccgctcaacgcgccaaacccgatagttctttgccttggt
ttattcctgatgggattgaatgcagccctcatcaacgtggccatgaacaccaccgctaca
aatctggaacgggcacagggtattgttatcatgtcgtcgtgccatggcatgtggagtctg
ggcggattgtttggctcaggtattgcaggggctgttatcgcgttgcatgtatcgcccccc
attcatatcatgatcatggcaggcttaattctgctcatgacttttattcttcaaccgatt
ctggcaaaaatcccgtcgagtagccgaacagaaacgggcgagaaagccgggtcgtcattc
gttcgacctaatctggacttgttgttaatgattttgatcggcttgtcgctggccatgggc
gaaggggccgctttcgactggagcgctgtgtatttgcgtgagacacttggcgccagcagt
cagattgccgcgctgggctttggcgcgttctcgctcactatgaccggtttccgtttcctg
ggcgatgcgatcatccctaaaataggtgccaaacgctggctacagattgggggagttatt
ggggcagcgggtctcttattcgccatcgctctcccctacccggcaacggcgttgattggc
tttggcgtgctgggagcaggttgctcgttgggtgcaccggtgctgtatgcggcctctatg
cgcgtagagggcattccgcccgcagctggcctggctacgtttgcgacatttagttttatt
ggctttctggcaggtccgcccatcatcgggtttgtagccgaagcctttggactggtgtat
ggattaggcttcgtagccatcatgctactgatttcggccggtttggccaaactagtaaag
ctattttga

DBGET integrated database retrieval system