KEGG   Spirosoma linguale: Slin_3427Help
Entry
Slin_3427         CDS       T01156                                 

Definition
(GenBank) LytTR family transcriptional regulator
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg LytTR
Motif
Other DBs
NCBI-GeneID: 8727180
NCBI-ProteinID: ADB39435
UniProt: D2QPC7
Position
complement(4154570..4155340)
Genome map
AA seq 256 aa AA seqDB search
MISDERIHILLVEDEGILAMELSDSLEADGYFIVGIANNGRKALDLFQRQRVDLLLCDIT
IKGDWDGIETVRRLTAERPIPVIYLTALTDRETLERAKQTYPAAYVNKPYQLASLRTAIE
LAIHNFNQRSKPVSAVAAPLEKGTRDRETILQINDHLFVKQNYQFVKINVDDLLYLEADN
VYTTLITGNRKYVIRLTLSGILERMNLPSLVRIHRSYAVNIHKVDSFNDTELSIGTQLLP
LSRSYKEEFLQRFNHY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattagtgacgagcgcatacatattctactggttgaagatgaaggtattttagctatg
gagttgagcgacagtctggaagcagacggctatttcatagtgggtattgcgaataatggg
cgcaaggcacttgacttattccagcggcagcgagttgatctactcctttgtgatattacc
ataaaaggcgattgggacggcattgaaacggttcgacggttaaccgccgaacggcccatt
cctgttatctacctgactgctcttacagaccgcgaaaccctggaaagggctaaacagacc
tacccggccgcgtatgtcaacaagccttatcaactggcaagtcttcgaaccgccattgag
ttggctattcacaatttcaaccagcggagtaagcccgtttcggcggtggcggccccgctc
gaaaagggtacacgtgatcgggagacaattctgcaaatcaatgatcatctgtttgtgaaa
cagaattaccagtttgtcaaaattaacgtcgatgacctgctgtatcttgaggccgacaac
gtgtatacgaccttaattacaggtaatcgaaaatacgtaattcggctaacattaagcggg
atattagaacggatgaatttgccgtctctcgtgcgaatccaccgatcctatgcggtcaat
attcacaaagtcgattcgttcaacgatacagaattgagcattggtacgcaattactgccg
ctaagcagaagttacaaagaggagtttttacagcgatttaatcattattga

DBGET integrated database retrieval system