KEGG   Spirosoma linguale: Slin_3432Help
Entry
Slin_3432         CDS       T01156                                 

Definition
(GenBank) xylose isomerase
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-GeneID: 8727185
NCBI-ProteinID: ADB39440
UniProt: D2QPD2
Position
complement(4160035..4161087)
Genome map
AA seq 350 aa AA seqDB search
MKTMKGPGIFLAQFLGDAEPFNNLESIAKYMADLGYKGIQIPTWDPRMIDLKQASESLTY
CDELKGKLKDIGVEITELATHLQGQLVAVHPAYGPMFDGFGPAELAGKPKEQQAWAVDQL
LMTAKASKNLGLVASPTFSGALLWPFVYPWPQRPAGLVETGFKELADRWLPILNAYDEAG
VDVAYELHPGEDLHDGITFEMFLEKVGNHPRAGINYDPSHFVLQQLDYLQFIDFYHDRIF
AYHVKDAEFNPTGKQGVYGGYQGWVERAGRFRSLGDGQVDFAGIFSKLAQYDYDRWAVLE
WECAIKHPEQGAAEGAPFISDHIIRVTERAFDDFAGTGADDAFNKKVLGL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatgaaaggtccgggcatattcttagcccagtttctaggggacgcagagccc
ttcaataacctggagtccattgccaaatacatggccgatctcggctataaaggaatccag
attcccacctgggacccacggatgatcgacctcaagcaggcttctgaaagcctgacctac
tgcgatgagctgaaaggcaagctgaaggatatcggcgtcgagatcactgaactcgccacg
caccttcaaggtcagttagtagcggtacatccggcctacggccctatgttcgatggcttc
ggtccggctgaactggcgggcaagcccaaagaacagcaggcatgggcggtcgatcagctg
ctgatgacggccaaagccagtaagaatctgggcctggtggctagtcctactttttcgggc
gcgctgctatggccattcgtatatccctggccacagcgtccggcgggtctggtcgaaacg
ggattcaaagaactcgccgaccgctggctacccatcctgaacgcctatgacgaagccggg
gtcgatgtggcgtatgagcttcaccccggcgaggatttgcacgacggtatcaccttcgag
atgttcctggagaaagtgggtaaccacccccgcgccggtatcaactacgacccaagccac
tttgtattgcaacagcttgattatttgcagttcatcgacttctaccacgaccgtattttc
gcctaccacgtgaaagacgccgagtttaacccaacgggtaagcagggcgtctatggtggc
tatcagggctgggtagagcgggccggacgcttccgttcgctgggcgacggtcaggttgac
ttcgcggggatcttctccaaactggctcagtacgactatgaccggtgggctgtgcttgag
tgggagtgcgccatcaaacaccccgaacagggggctgccgaaggggctccgttcatttcg
gatcatatcatccgcgtgaccgaacgcgctttcgacgacttcgccggaaccggtgctgat
gacgcattcaataagaaagtactagggttgtaa

DBGET integrated database retrieval system