KEGG   Spirosoma linguale: Slin_4652Help
Entry
Slin_4652         CDS       T01156                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sli  Spirosoma linguale
Pathway
sli00430  Taurine and hypotaurine metabolism
sli00460  Cyanoamino acid metabolism
sli00480  Glutathione metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Slin_4652
   00460 Cyanoamino acid metabolism
    Slin_4652
   00480 Glutathione metabolism
    Slin_4652
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sli01002]
    Slin_4652
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Slin_4652
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Slin_4652
Peptidases and inhibitors [BR:sli01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Slin_4652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 8728416
NCBI-ProteinID: ADB40630
UniProt: D2QPH1
Position
complement(5664121..5665929)
Genome map
AA seq 602 aa AA seqDB search
MNIRLVPYYCLLGFTLVVASCKTQSTTTTTADTKVKQSQGVYQYRDEDPTVKPFFSDRVG
VIGRNGMVASAHPEASQVGLAILKAGGNAVDAAVAVQFALAVVYPGAGNIGGGGFMVYRD
KAGKAYSLDYREKAPGRATQNMYLDSLGNVRPGLSISGHLASGVPGSVDGMVEAHKRFGK
LTWAQVLQPAIDLASKGFPLTERDALGLNRIKTDLNTINPGKAYFLKSVAPADTVSWHKG
DLLIQADLAKTLQRIQAQGRAGFYEGETARLLAEEMVRGKGLITEEDLKNYHSIWRDPIL
AAYKNYNVITMPPTSSGGIALVQMMRFTEPYPLRKWGWNKDSTVQVMIEAERRVYADRAK
FLGDPDFVKVPATQLMSPEYLRTRWTDFSWAKATDSRAVRGGTIPGYESLETTHFSVVDK
EGNAVSITTTLNGGYGSRVVIGGAGFFMNNEMDDFSIKPGSPNMYGLIGNQANAIAPHKR
MLSSMTPTILEKDGKLFMVVGTPGGSTIMTSVYQTILNVIEHGMTMQQSVNALKFHHQWL
PDKTIFENGAFSTATIEALKSRGYILEQLSNTLGRMDCVLVRPDGSYEGASDPRADNTAR
GY
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacgtctcgttccttattactgcctgctcggatttaccctggtggtcgcttcc
tgcaaaacacagtcgaccacaaccacaactgccgatacaaaagttaagcaaagccagggt
gtgtaccaataccgcgatgaggacccaacggttaagccgttcttctcggatcgggtgggt
gtaatcgggcgaaatggcatggtggcatcggcccatcccgaagcttcgcaggtggggctg
gctattctgaaagcgggtggcaatgcagtcgatgcggccgtagcagtgcagtttgcactg
gcggtggtgtatcccggcgcggggaacattggcgggggcggctttatggtgtatcgggat
aaagccgggaaagcctactcgctcgattaccgggaaaaggcccccggacgggctacccag
aatatgtacctcgattcgctgggaaatgtacggccaggcctgagtatcagcggacatctg
gccagtggcgtacccggttcggttgacgggatggtcgaagcccacaagcggttcgggaag
ctaacctgggctcaggtgttgcagcccgctatcgacctcgccagcaaaggctttcccttg
acggagcgggatgccctcgggctcaaccggatcaaaacggacctgaacacgattaatccc
ggcaaagcgtattttctgaaaagtgtggcaccggctgataccgtatcctggcacaagggc
gatttgctgatacaggccgatctggccaaaacgcttcagcgcattcaggcgcaggggcgg
gcgggcttttacgagggcgaaacggcgcgtctgctggcggaagaaatggtacgcggcaaa
ggcttgataacggaagaagacctgaaaaactaccactccatctggcgcgatcccatcctg
gcggcctacaaaaattataacgtcattaccatgccgcctacctcaagcggtggcatcgcg
ttggtgcagatgatgcgctttacggagccctacccgctgcgtaaatggggctggaataag
gacagcaccgtgcaggttatgatcgaagccgaacgccgggtatacgccgaccgggccaag
tttctgggtgaccccgactttgtgaaagttcccgccacacaactgatgagccctgagtac
ctgcgcacccgctggacggatttctcgtgggccaaagcaaccgatagccgggcggtgcgg
ggcggtaccattccgggttacgagagtctggaaactacccacttttcggtggtcgataaa
gaaggcaatgccgtgagtatcaccaccaccctcaacggtggatacggcagccgggtcgtc
attggcggagccgggtttttcatgaataacgaaatggatgatttcagcatcaagcccgga
tcgcccaatatgtatggattgatcggtaatcaggcaaatgccattgcgccccataagcgc
atgctgtcgtccatgacccctaccattctggaaaaagacggcaaattgttcatggtggta
ggcacgccgggtgggtcaacgatcatgacatcggtataccaaaccatcctgaacgtgatt
gaacacggcatgaccatgcagcagtcggtcaatgcgctgaaatttcaccaccagtggcta
cccgacaaaacgattttcgaaaacggagccttttccactgccaccattgaagctctgaaa
agtcgtggttatattctggaacagctcagtaacaccctcgggcgtatggactgcgtgctg
gttcgccccgacggctcctacgaaggcgcatctgacccccgagcggataatacggcacga
gggtattga

DBGET integrated database retrieval system