KEGG   Spirosoma linguale: Slin_4813Help
Entry
Slin_4813         CDS       T01156                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sli  Spirosoma linguale
Pathway
sli00521  Streptomycin biosynthesis
sli00523  Polyketide sugar unit biosynthesis
sli01130  Biosynthesis of antibiotics
Module
sli_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Slin_4813
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slin_4813
Enzymes [BR:sli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Slin_4813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2 FdtA Cupin_1 DUF1971
Motif
Other DBs
NCBI-GeneID: 8728577
NCBI-ProteinID: ADB40791
UniProt: D2QQL0
Position
complement(5870528..5871049)
Genome map
AA seq 173 aa AA seqDB search
MNNWYIDGLQKDKQSITADWNRHKQSLIAGVEVREVKNVIKSNGHLTEIYRKDWQLDDSP
VDQVFQIMMQPGGISAWHAHESTTDRLFVTLGTMKIVLYDSRQLSPTFGQINEFLVSDLR
PQLISVPPQVWHGVKNISANAALMLNLVDKAYQYDDPDHWRVPADSPAIPYTL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaataattggtatatcgatggattacaaaaagataaacagagtataaccgccgactgg
aacaggcataagcagtccctgattgcgggcgttgaggtgcgggaggtgaaaaacgtcatt
aagagtaacggtcatttaaccgagatttatcgtaaagactggcaactggatgattcgccg
gtcgatcaggtgtttcagatcatgatgcagccgggaggaatctccgcctggcacgcgcat
gagtcgacaacagatcggttatttgtgacgttaggcacgatgaaaatcgttttgtacgac
tctcgtcaactttctcccacgttcgggcagataaatgagtttctcgtcagtgatttgcgc
ccgcagttgatatccgttcctcctcaggtctggcatggggtaaaaaacataagcgccaat
gccgctcttatgctaaatctggtggataaagcctatcaatacgacgacccggaccattgg
cgtgtaccggcagatagtccggctattccatacacactataa

DBGET integrated database retrieval system