KEGG   Spirosoma linguale: Slin_6319Help
Entry
Slin_6319         CDS       T01156                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sli  Spirosoma linguale
Pathway
sli00360  Phenylalanine metabolism
sli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sli00790  Folate biosynthesis
sli01100  Metabolic pathways
sli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Slin_6319
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_6319
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Slin_6319
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Slin_6319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 8730103
NCBI-ProteinID: ADB42278
UniProt: D2QTZ6
Position
complement(7668564..7669349)
Genome map
AA seq 261 aa AA seqDB search
MSEWFPAFILSFRHSIIDSLVMQTYTKYTPDDQAVWRLLFERQMAQLPGKASQDYLDGIS
ATGFRADRIPNFERDLNPNLQRLTGWRVAAVDGLIPNREFFELMANRNFPATTWLRRRDQ
LEYLPEPDMFHDTFGHVPMLSNQAFCDFLASLSRIALDHIDSEEAISMISRLYWYTVEFG
LIREGNELRIYGGGILSSVGETAYSLYSEVPKRIPYDVATLLQTPYIIDHYQEQYFVIES
YEQLYQSVPQIEETLESLLVS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatggtttccggcatttattctatcattcaggcattctatcattgactcatta
gttatgcagacatacaccaaatacaccccggacgatcaggccgtttggcggctacttttc
gagcggcagatggcccaactgcccggaaaagccagtcaggattacctcgacgggatttcg
gcaacgggattccgggccgaccgtatcccaaatttcgagcgggatctgaacccaaatctg
caacggcttacgggctggcgggtcgcggctgttgatgggcttattcccaaccgggagttt
tttgagttgatggccaaccggaattttccggcaacgacctggctgcgtcggcgcgaccag
ttggagtacctgcccgagccggatatgtttcacgacaccttcggacacgtgccgatgctg
tccaaccaggcattttgtgatttcctggcatcgctgagccggattgcgctagatcatatc
gacagcgaagaagcaatttccatgatttcgcggctgtactggtacaccgtggagtttggc
ctgattcgcgaagggaatgaactgcggatttacggcgggggtattctgtcgtcggtgggc
gaaacggcttacagtctgtacagtgaggtgccgaagcgtattccgtacgatgtggcgaca
ctgcttcagacgccgtacatcatcgaccattaccaggagcagtatttcgtgatcgagtcg
tacgagcagctgtaccagtccgtacctcagattgaagagacgctggaaagcttattggtt
agttga

DBGET integrated database retrieval system