KEGG   Sulfuricaulis limicola: SCL_1971Help
Entry
SCL_1971          CDS       T05241                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00020  Citrate cycle (TCA cycle)
slim00480  Glutathione metabolism
slim01100  Metabolic pathways
slim01110  Biosynthesis of secondary metabolites
slim01120  Microbial metabolism in diverse environments
slim01130  Biosynthesis of antibiotics
slim01200  Carbon metabolism
slim01210  2-Oxocarboxylic acid metabolism
slim01230  Biosynthesis of amino acids
Module
slim_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCL_1971
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCL_1971
Enzymes [BR:slim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCL_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAV34262
UniProt: A0A1B4XHI6
Position
complement(2031602..2032858)
Genome map
AA seq 418 aa AA seqDB search
MAFTHIRIPAGEKISVNKDYSLNVPNNPIIPFIEGDGIGRDITPVMRKVVDAAVTRAYGG
KRSIAWMEVYAGEKAVATYGNNTWLPAETFQAVREYVVSIKGPLTTPVGGGIRSLNVSLR
QELDLYVCLRPVRYFKGVPSPVKEPEKTDMVIFRENSEDIYAGIEWPSGSPEAQKLIAFL
QREMGVKKIRFPETSAIGIKPVSREGTERLVRRAIQYAIANDRPSVTLVHKGNIMKFTEG
GFKSWGYELAQREFGAQLIDQGPWMRLNNPKTGKEIVIKDVIADAFLQQILLRPAEYSVI
ATLNLNGDYISDALAAQVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDMVNPGSMILS
AEMMLRHLGWVEAADLILKGMEGAISARTVTYDFARLMPGATQVSCSGFGDAIIGSMK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcttttacgcacatcaggatccccgccggggaaaaaatctcggtcaacaaggattac
tcgctgaatgtcccgaacaatccgatcattccctttatcgagggtgatggcatcggacgc
gacatcaccccggtcatgcgcaaggtcgtggatgcggccgtcaccagggcctacggcggc
aagcgttcgattgcctggatggaagtgtacgcgggcgaaaaagcggttgcgacctacggc
aacaacacctggctgccggcggaaaccttccaggcggtcagggagtatgtcgtctcgatc
aaggggccgctgacaacgccggtgggcggcggcatccgttcgctcaacgtgtcgttgcgc
caggaactcgatctgtatgtctgcctgcggccggtgcgttacttcaagggtgtgccgagt
ccggtgaaggaaccggagaaaaccgacatggtgatcttccgcgaaaactcggaagacatc
tacgccggcatcgagtggccgtccggctcgcccgaggcgcaaaagctgatcgccttcctg
cagcgcgaaatgggcgtgaagaaaatccgctttccggaaacctccgccatcggcatcaag
ccggtgtcgcgcgagggcacggaacggctggtgcgccgcgccatccagtacgccatcgcc
aacgatcggccctccgtgacgctggtgcacaagggcaacatcatgaaattcaccgaaggc
ggtttcaagagctggggctacgaactggcgcagcgtgaattcggcgcgcagctgatcgac
caaggcccgtggatgcgcctgaacaacccgaagaccgggaaggagatcgtgatcaaggac
gtgattgccgacgccttcctgcaacaaatcctgctgcggccggcggaatacagcgtgatc
gccacgctcaatctcaacggcgattacatctcggacgcgctggcggcgcaggtcggcggc
atcggcattgcgccgggcgcgaacctgtccgacaccgtggcgatgttcgaggccacgcac
ggcaccgcgcccaagtatgccggcaaggacatggtcaaccccggttccatgatcctgtcg
gccgagatgatgctgcgtcacctgggctgggtggaagcggccgatctgatccttaaagga
atggaaggggcgatttccgccagaacggtcacttacgattttgcgcggctcatgcccggt
gccacccaggtgagttgctcgggttttggcgatgccattatcggttccatgaaataa

DBGET integrated database retrieval system