KEGG   Sulfuricaulis limicola: SCL_2036Help
Entry
SCL_2036          CDS       T05241                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00620  Pyruvate metabolism
slim00630  Glyoxylate and dicarboxylate metabolism
slim01100  Metabolic pathways
slim01110  Biosynthesis of secondary metabolites
slim01120  Microbial metabolism in diverse environments
slim01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCL_2036
   00630 Glyoxylate and dicarboxylate metabolism
    SCL_2036
Enzymes [BR:slim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCL_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAV34327
UniProt: A0A1B4XHQ7
Position
2098662..2100266
Genome map
AA seq 534 aa AA seqDB search
MNKPLAMPAGMVLRAEAPEEYAGILTPEALDFVADLARRFGPGREQLLARRAERQAQLDR
GIKPEFPFETRAVREADWTVAPVPAEIQDRRVEITGPVERKMIINALNSGANVFLADLED
SLAPTWDNVIRGQVNLRDAVRRSISYDSPEGKHYTLNTKTAILFVRPRGWHLTEKHVLVD
GKPVSASLFDFGLYFFHNARALLERGTAPYFYLPKLESYLEARLWNEVFLWAQERLGIPR
GTIKATVLIETILAAFDMDEILYELREHSAGLNCGRWDYLFSTIKKFHNDPDFILADRGQ
VSMTAPFMLAYSLLLIQTCHRRNAHAMGGMAAQIPIKSNPAANEAALAKVRADKEREAKD
GHDGTWVAHPGLVPLAKDVFDRLMPTPNQIHRKRHDVLVPASDLLAFAPKAPITEAGLRL
NIEVGIEYLGAWLAGTGCVQIHNLMEDAATAEISCSQVWHWIRSKKGVLSDGRKVTLELA
QKMIPEELQRIHMSLGEKIYAAGKYELAAQLFDKFIGTEPMPEFLTLLGYDYLD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccttagcgatgcccgcgggcatggtcctccgggccgaggcgcccgaggaa
tatgccggtatcctgaccccggaagcgctcgatttcgttgcggacctggcgcggcgtttc
gggcccgggcgggaacaactgctggcgcggcgagcggagcgtcaggcgcagctggaccgc
ggcatcaaaccggagttcccgttcgagacccgcgcggtgcgcgaggccgactggaccgtg
gcgccggtgccggcggagatacaggaccgccgcgtcgagatcaccgggccggtggaacgc
aagatgatcatcaacgcgctcaattccggggccaatgtcttcctcgccgatctcgaagac
tcgctcgcgcccacctgggacaacgtcatccgggggcaagtgaacctgcgcgacgccgtg
cggcgctcgatcagttacgacagcccggaaggcaagcattacacgctgaacaccaaaacg
gcgatcctgttcgtgcgcccgcgcggctggcacctgaccgaaaagcatgtgctggtggat
ggcaagccggtgtcggccagcctgttcgattttggcttgtatttctttcacaacgccagg
gcgctgctcgaacgcggcaccgcgccctacttctacctgcccaagctggaaagctatctc
gaagcccggttatggaacgaggtgttcctgtgggcgcaggagcgcctgggcattccgcgc
ggcaccatcaaggccacggtgctgatcgaaaccatcctcgcggctttcgacatggacgaa
atcctgtacgaactgcgcgaacattcggccggcctcaattgcggccgctgggattatctt
ttcagcaccatcaagaagttccacaacgacccggatttcatcctcgccgaccgcgggcag
gtcagcatgacggcgccgttcatgctggcgtattcgctgctgctgatacaaacctgccac
cggcgcaacgcccacgccatgggcgggatggcggcgcagattccgatcaagtccaacccg
gcggcgaacgaggccgcgctggccaaggtgcgcgccgacaaggagcgcgaggccaaggac
ggacatgacggcacctgggtggcgcatccggggctggtaccgctggcgaaagacgtcttc
gaccggctcatgcccacgccgaaccagattcatcgcaagcgccacgacgtgctggtgccc
gcttccgacctgctcgccttcgccccgaaggcaccgatcacggaggccgggctgcgcctc
aacatcgaggtcggcatcgaatacctgggcgcgtggctggccggcaccggctgcgtgcag
attcacaacctcatggaagacgccgccactgcggagatttcgtgctcgcaggtgtggcac
tggatacgcagcaagaaaggcgtgctcagcgatgggcgcaaggtcacgctggaactggcg
caaaagatgattccggaagaactccagcgcatccatatgtcgctcggcgagaagatttat
gccgctggcaaatacgaactcgcggcgcagttgttcgacaagttcatcggcaccgagccg
atgccggagttcctgacgttgctcggctacgactatctcgactga

DBGET integrated database retrieval system