KEGG   Sulfuricaulis limicola: SCL_2292Help
Entry
SCL_2292          CDS       T05241                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
slim  Sulfuricaulis limicola
Pathway
slim03010  Ribosome
Brite
KEGG Orthology (KO) [BR:slim00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SCL_2292
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:slim03011]
    SCL_2292
Ribosome [BR:slim03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SCL_2292
  Bacteria
    SCL_2292
  Archaea
    SCL_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145 DUF5610
Motif
Other DBs
NCBI-ProteinID: BAV34580
UniProt: A0A1B4XIF0
Position
complement(2337276..2337644)
Genome map
AA seq 122 aa AA seqDB search
MQATAILKYVRVSAQKGRLVADQVRGLPVARALELLQFSPKKAAAHVRKVLESAIANAEH
NEGADVDELKVATIQVDGGPTLRRFHSRAKGRGVRILKRTSHITVVVSDEKKPSKAVKKE
KS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctacagccattctgaaatatgtccgggtgtccgcgcaaaagggacgtctcgtc
gcggatcaggttcgcgggctgccggtcgcgcgcgcgctcgaactgctccagttcagcccc
aagaaggctgcggcgcacgtgcgcaaggtcctcgaatcggccatcgccaatgccgaacac
aacgaaggcgcggacgtggacgaactcaaggtggcgaccatccaggtggacggcggaccg
acgttgcgacgcttccattcgcgtgccaaggggcgcggcgtgcgcatcctcaagcgcacc
agccatatcaccgtggtggtgagcgacgagaagaagccgtcgaaggccgtgaagaaggag
aaaagctga

DBGET integrated database retrieval system