KEGG   Shewanella livingstonensis: EGC82_01150Help
Entry
EGC82_01150       CDS       T05875                                 

Gene name
glyQ
Definition
(GenBank) glycine--tRNA ligase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
slj  Shewanella livingstonensis
Pathway
slj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:slj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EGC82_01150 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slj01007]
    EGC82_01150 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slj03016]
    EGC82_01150 (glyQ)
Enzymes [BR:slj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     EGC82_01150 (glyQ)
Amino acid related enzymes [BR:slj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   EGC82_01150 (glyQ)
Transfer RNA biogenesis [BR:slj03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EGC82_01150 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AZG71497
UniProt: A0A3G8LQ23
Position
complement(256883..257788)
Genome map
AA seq 301 aa AA seqDB search
MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYV
QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLEALGIDTKVHDIRFVED
NWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQEVDS
VYDLVWTDGPRGRVTYGDIFHQNEVEQSTYNFEHADVDFMFTLFDQCEKMCMHLLSLEKP
LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREALGFPLC
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaacacgacgtaaagacatttcaagggttcatcctaaccctgcaggaatat
tgggcgcagcaaggttgcgcaattgttcaacctcttgatatggaagttggtgctggtact
ttccacccgcagacgttcttacgttcattaggccctgagccaatgagcagtgcatacgtg
caaccgtctcgccgtcctactgatggacgttatggtgaaaaccctaaccgcctacaacac
tactatcaatttcaagtagtactaaagccatctccagacaacattcaagagctttattta
ggctcgcttgaagcgcttggtatcgataccaaagtacatgatattcgctttgttgaagac
aactgggaatcgccgacattaggcgcatggggtttaggttgggaaatatggcttaatggt
atggaggtgactcagtttacttacttccagcaggttggcggtattgaatgtagcccagtt
accggtgaaatcacctacggtctagaacgtcttgctatgtacattcaagaagttgatagc
gtatatgaccttgtatggaccgacggaccacgcggtcgtgtaacctacggtgacattttt
catcaaaacgaagttgaacaatcaacgtataacttcgaacatgccgatgtcgactttatg
tttaccctattcgatcaatgtgaaaaaatgtgcatgcacttattatcactcgaaaagccg
ttaccactacctgcctacgagcaagtaatgaaagcctcacacgcttttaacctacttgat
gctcgccatgctatttctgtcaccgaacgccagcgttatatccttcgcgttcgtactatg
gcaaaaggtgttgcagaatcttattatcaagcacgtgaagcccttggcttcccactgtgt
aagtag

DBGET integrated database retrieval system