KEGG   Shewanella livingstonensis: EGC82_01345Help
Entry
EGC82_01345       CDS       T05875                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
slj  Shewanella livingstonensis
Pathway
slj00860  Porphyrin and chlorophyll metabolism
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
Module
slj_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EGC82_01345 (hemN)
Enzymes [BR:slj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     EGC82_01345 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AZG71532
UniProt: A0A3G8LRN6
Position
complement(301805..303181)
Genome map
AA seq 458 aa AA seqDB search
MKQPTQISWDQSMIEKYNYSGPRYTSYPTALEFDDAFTEQNLLTSIKNSKSDKLSLYVHI
PFCAKLCYYCGCNKIITRHAHKADQYIEYLATEIIKRAPLFKNYTVTQMHWGGGTPTFLS
PEQILKLTALIKQHFNFADVGEYSIEVDPREIELSMLDTLKEAGFNRVSIGVQDFNKEVQ
IAVNREQDEQFIFDLIARAKELGFVSTNVDLIYGLPLQTPETFAKTIARIIELSPDRLSV
FNYAHLPSRFAAQRKIKEHDMPAPQQKLDMLRQTIESLTGAGYQFIGMDHFAKPNDELAK
LQNAGKLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYESIDANGHALWK
GCSLNHDDEIRRAVIKQIICHFDLDMAKIEQKFAINFDEYFAEDLKLLQTFINDKLVDIT
DRKLTVSQTGRLLIRNICMCFDVYYRQKARQQQFSRVI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcagcccactcagattagttgggatcagtcgatgatcgaaaaatacaattacagc
ggtccccgttatacttcttacccgaccgcactagagtttgacgatgcctttactgagcaa
aatttactgacatctattaaaaatagtaaatcagataaactgtcgctatatgtacatatc
cctttttgcgccaaactttgctattactgtggttgtaataaaattattactcgccacgca
cacaaagctgatcaatatattgaatatctggccactgaaattattaaacgcgccccatta
ttcaaaaattacaccgtaacccaaatgcattggggtggcggtacaccgacatttttaagc
cctgaacaaattcttaaactgactgcactaattaaacaacactttaattttgctgatgtg
ggtgaatactcaattgaagttgacccgcgagagatagagctcagcatgttagacacctta
aaagaagctgggtttaaccgggtgtctattggtgttcaagactttaataaagaagtacaa
attgccgttaaccgtgagcaagacgaacaatttatttttgacttaattgccagagctaaa
gaactcggttttgtatccactaacgttgatttaatttacggtttaccgctgcaaacacca
gaaacctttgcgaaaactattgcgcgcattattgagctatcgccagatcgtctatctgtc
tttaactatgcacatctaccatcgcgttttgctgcacaacgtaaaattaaagaacatgat
atgcctgctccacaacagaaattagatatgcttcgccaaacgatagagtcattaaccggt
gcgggttatcaatttattggtatggaccattttgccaaacccaatgatgagttggcaaag
ttacaaaatgccggcaaattacatcgtaactttcaagggtacaccacccaagaagaatgt
gatttgcttgggttaggggtatcatctatcagccaaattggcgactgctatgcccaaaat
caaaaagatattcgtccatactacgaatctattgatgctaatggtcatgcattatggaaa
ggctgtagcttaaatcacgatgatgaaattcgtcgcgcggtcattaaacagattatctgt
cattttgatttagacatggccaaaattgaacaaaagtttgccattaactttgatgaatat
tttgctgaagaccttaaactattgcaaacattcattaatgataaattggttgatatcact
gatcgaaagttaacagtaagccagaccggtcgtctacttattcgtaatatctgcatgtgt
tttgatgtatattatcgtcaaaaagcccgtcagcagcagttttcaagagttatttaa

DBGET integrated database retrieval system