KEGG   Shewanella livingstonensis: EGC82_01750Help
Entry
EGC82_01750       CDS       T05875                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
slj  Shewanella livingstonensis
Pathway
slj00450  Selenocompound metabolism
slj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EGC82_01750 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slj03016]
    EGC82_01750 (selD)
Enzymes [BR:slj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EGC82_01750 (selD)
Transfer RNA biogenesis [BR:slj03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EGC82_01750 (selD)
 Prokaryotic Type
    EGC82_01750 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AZG71607
UniProt: A0A3G8LQC1
Position
complement(383497..384552)
Genome map
AA seq 351 aa AA seqDB search
MSEQAIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQTRDDAAVYKLNEQ
TGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPIMAIAILGWPINILPAEVAQQ
VVDGGRQACADAGIMLAGGHSIDSPEPIFGLAVTGQIPLERVKQNNTAKAGDRLYLTKPI
GIGILTTAQKQKKLRDEDSQIAPDAMCQLNKIGIDIAKIVGVNALTDVTGFGLAGHLIEV
CQGAQLKANLVLSKVPLLDKVSDYLAFGCIPGGTHRNFDSYSEYLPPLTDDQKAIICDPQ
TSGGLLVAVSEDAEHELKVLLETNGIEAICIGMLNTYKPHSDGHNILVELS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaagcaattaaacttaccgaatatagtcatggcgcaggctgcggctgtaag
atttctcctaaagtgttaagtaccattcttgcatcacaactccctgtctttactgatcct
aatttattagttggtaatcaaactcgtgacgatgctgccgtctataaacttaacgaacaa
actggcattatcagcaccacagacttctttatgcctattgtagatgacccatttaccttt
ggcagaattgcagccactaatgccattagcgacatatacgctatgggtggtactcctata
atggcgattgctattttaggttggccaattaatatactacctgccgaagttgcccaacaa
gttgttgatggtggacgtcaagcctgcgctgatgctggcattatgctcgcgggcggtcac
agtattgattctcctgagcctatttttggtttagccgtaacagggcaaattccacttgag
cgagtaaagcaaaacaatacagccaaagccggcgaccgtttgtacctcactaaacctatt
ggtattggtattcttactaccgcacaaaaacagaaaaaactacgtgatgaagacagtcaa
attgcacctgatgcgatgtgtcagctcaacaaaatagggattgatatcgctaaaattgtt
ggtgttaatgcattaactgatgtaactggatttgggcttgccggccacttgatagaagtc
tgccagggcgcccaacttaaagctaacttagtattatctaaagttcctttattggataaa
gtcagtgattatcttgcatttggttgtattccaggcggaacccatcgtaactttgacagt
tatagtgaatatttaccgccattaactgatgaccagaaagcgattatctgcgatccacaa
accagtggcggattattagtcgctgtaagtgaagatgctgaacatgaacttaaagtctta
ttagaaaccaatggcattgaagcgatttgtatcggtatgctcaatacctataaacctcat
tctgacggccacaatatccttgtggaattgagctaa

DBGET integrated database retrieval system