KEGG   Shewanella livingstonensis: EGC82_01955Help
Entry
EGC82_01955       CDS       T05875                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
slj  Shewanella livingstonensis
Pathway
slj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:slj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EGC82_01955 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:slj03011]
    EGC82_01955 (rplV)
Ribosome [BR:slj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EGC82_01955 (rplV)
  Bacteria
    EGC82_01955 (rplV)
  Archaea
    EGC82_01955 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AZG71638
UniProt: A0A3G8LSC0
Position
425804..426136
Genome map
AA seq 110 aa AA seqDB search
MEVLAKHRFARTSAQKARLVADQIRGLSVSKALEILTFSPKKAAVLVKKVLDSAIANAEH
NEGADIDELKVGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagttttagctaaacatcgttttgctcgtacgtctgcgcagaaggcccgtctagtt
gctgatcaaattcgtggattgtctgtttcaaaggcactcgaaattttgacattcagcccc
aagaaagccgccgtactagttaaaaaagtacttgactcagctatcgcaaacgccgaacac
aacgaaggtgctgacattgatgagcttaaagttggagccgtcttcgtagatgaaggccca
acaatgaagcgtatcatgccacgtgctaaaggccgcgctgatcgtatcatgaagcgtacc
agccacattactgtggttgtatcagatcgctag

DBGET integrated database retrieval system