KEGG   Shewanella livingstonensis: EGC82_04365Help
Entry
EGC82_04365       CDS       T05875                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
slj  Shewanella livingstonensis
Brite
KEGG Orthology (KO) [BR:slj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EGC82_04365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMPIT
Motif
Other DBs
NCBI-ProteinID: AZG72065
UniProt: A0A3G8LS86
Position
1002311..1003579
Genome map
AA seq 422 aa AA seqDB search
MVDVLVTNGPTLIMIAAAFGFLMAWGIGANDVANAMGTSVGSNAITIKQAIIIAMIFEFA
GAFLAGGEVTSTIRKGIIDASYFTDVPELLVYGMIASLLAAGIWLVVASALGWPVSTTHS
IIGAIVGFAAVGVSADAVEWGKVGGIIGSWVITPAISGFIAFIIFQSVQKLIFNTDDPLA
SAKRYVPFYMALAGFVMSLVTITKGLSHVGINFSTIEAYFLAAVVATVVGLLGKVAISRL
KMSDKADIKTQYGNVEKVFAILMVVTACCMAFAHGSNDVANAIGPLAAVVSVVESGGVIG
AQAVLAWWILPLGAVGIVMGLAIFGQRVMQTIGKNITHLTPSRGFAAELAAASTVVIASG
TGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSWVITLPAGAALSILFFFIIKNI
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtattagtcaccaacggccctacgcttattatgatagcggctgcatttgga
tttttgatggcatggggtattggtgcaaacgacgtagccaatgcaatgggaacctctgta
ggttctaatgccattaccattaaacaagcgattattattgcaatgatctttgaattcgcc
ggtgcgtttttagccggtggtgaagtcacgagtaccattcgtaaaggtattatcgacgcg
agttactttacagatgtccctgaattgttggtatacggcatgattgcctcattactcgct
gcaggtatttggttagtggttgcctcagcgttaggctggccggtttcgacaacacattca
attattggtgctattgtcggtttcgctgcagtgggtgtcagtgcagatgcagttgaatgg
ggtaaagttggcggtattattggctcttgggtaataactccggccatttcgggctttatt
gcttttatcatttttcaaagtgtacaaaagctaatttttaacaccgatgatccgttagcg
agcgcgaagcgttatgtgcctttttacatggcattggccggttttgtaatgtcacttgtg
accattactaaaggcttatcacatgtgggtataaacttttcaacaattgaagcttatttt
ttagcggcagttgtcgctaccgtagtcggtcttctaggtaaagtagccattagtcgttta
aaaatgagcgacaaagctgacataaaaacccaatatggtaacgttgaaaaagtctttgcc
atattgatggttgtgacagcgtgttgtatggcatttgcccatggatcaaacgatgttgcc
aatgctattggtcctttagctgctgtagtctcagtagttgaaagtggcggtgttattggt
gctcaagcggttctagcatggtggattttaccacttggtgctgttggtattgtgatgggt
ttggctattttcggtcagcgcgtgatgcaaaccattggtaagaacattactcatttaacg
ccaagtcgcggctttgctgctgaattagctgccgcatcgaccgtagttattgcttctggt
accggtttacctatctcgactacgcaaactttagtgggtgctgtgttaggtgtgggtatg
gcacgtggtattgcagcaatcaatattggtgtagtgcgtaacattgttgtgtcttgggtt
attaccctgccagcaggtgccgcattgtctattttgttcttcttcattatcaaaaatatc
ttcagttaa

DBGET integrated database retrieval system